Submit Data |  Help |  Video Tutorials |  News |  Publications |  FTP Download |  REST API |  Citing RGD |  Contact   

ONTOLOGY REPORT - ANNOTATIONS


Term:polypeptide
go back to main search page
Accession:CHEBI:15841 term browser browse the term
Definition:A peptide containing ten or more amino acid residues.
Synonyms:exact_synonym: polypeptides
 related_synonym: Formula=C4H6N2O3R2(C2H2NOR)n;   Polypeptid;   polipeptido
 alt_id: CHEBI:14860;   CHEBI:8314
 xref: KEGG:C00403


show annotations for term's descendants       view all columns           Sort by:
 
afamelanotide term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Mc4r melanocortin 4 receptor JBrowse link 18 62,612,838 62,614,725 RGD:6480464
astressin term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Crhr1 corticotropin releasing hormone receptor 1 JBrowse link 10 92,191,473 92,233,662 RGD:6480464
G Crhr2 corticotropin releasing hormone receptor 2 JBrowse link 4 85,286,371 85,329,374 RGD:6480464
G Cyp11a1 cytochrome P450, family 11, subfamily a, polypeptide 1 JBrowse link 8 62,798,317 62,809,848 RGD:6480464
G Cyp17a1 cytochrome P450, family 17, subfamily a, polypeptide 1 JBrowse link 1 266,422,127 266,429,947 RGD:6480464
G Star steroidogenic acute regulatory protein JBrowse link 16 71,036,204 71,040,847 RGD:6480464
G Sult2a1 sulfotransferase family 2A member 1 JBrowse link 1 76,558,721 76,614,315 RGD:6480464
G Ucn urocortin JBrowse link 6 26,602,144 26,602,974 RGD:6480464
astressin 2B term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Ccl2 C-C motif chemokine ligand 2 JBrowse link 10 69,412,065 69,413,863 RGD:6480464
G Cxcl3 C-X-C motif chemokine ligand 3 JBrowse link 14 18,820,168 18,839,659 RGD:6480464
G Il6 interleukin 6 JBrowse link 4 3,043,231 3,047,807 RGD:6480464
G Pomc proopiomelanocortin JBrowse link 6 28,382,937 28,388,771 RGD:6480464
G Tnf tumor necrosis factor JBrowse link 20 5,189,382 5,192,000 RGD:6480464
G Ucn urocortin JBrowse link 6 26,602,144 26,602,974 RGD:6480464
bacitracin term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G A2m alpha-2-macroglobulin JBrowse link 4 154,309,426 154,359,138 RGD:6480464
G Ache acetylcholinesterase JBrowse link 12 22,472,358 22,477,052 RGD:6480464
G Aldh1a1 aldehyde dehydrogenase 1 family, member A1 JBrowse link 1 238,222,689 238,264,381 RGD:6480464
G Anxa5 annexin A5 JBrowse link 2 123,162,477 123,194,730 RGD:6480464
G Bmp1 bone morphogenetic protein 1 JBrowse link 15 52,166,401 52,210,786 RGD:6480464
G Bmp4 bone morphogenetic protein 4 JBrowse link 15 20,776,060 20,791,013 RGD:6480464
G Calb1 calbindin 1 JBrowse link 5 29,538,380 29,562,774 RGD:6480464
G Cat catalase JBrowse link 3 93,379,872 93,412,058 RGD:6480464
G Ccn1 cellular communication network factor 1 JBrowse link 2 251,529,354 251,532,312 RGD:6480464
G Ccnd1 cyclin D1 JBrowse link 1 218,090,750 218,100,447 RGD:6480464
G Ccng1 cyclin G1 JBrowse link 10 25,903,925 25,910,298 RGD:6480464
G Cd24 CD24 molecule JBrowse link 20 48,335,540 48,340,847 RGD:6480464
G Cd44 CD44 molecule (Indian blood group) JBrowse link 3 92,695,083 92,783,820 RGD:6480464
G Clu clusterin JBrowse link 15 42,626,612 42,665,858 RGD:6480464
G Cp ceruloplasmin JBrowse link 2 104,744,249 104,803,034 RGD:6480464
G Ctss cathepsin S JBrowse link 2 197,655,780 197,679,768 RGD:6480464
G Cyp2d4 cytochrome P450, family 2, subfamily d, polypeptide 4 JBrowse link 7 123,599,264 123,608,436 RGD:6480464
G Egf epidermal growth factor JBrowse link 2 68,820,616 68,895,537 RGD:6480464
G Fn1 fibronectin 1 JBrowse link 9 78,900,111 78,969,018 RGD:6480464
G G6pc glucose-6-phosphatase, catalytic subunit JBrowse link 10 89,286,009 89,296,213 RGD:6480464
G Gadd45a growth arrest and DNA-damage-inducible, alpha JBrowse link 4 97,782,512 97,784,814 RGD:6480464
G Ghr growth hormone receptor JBrowse link 2 53,149,225 53,413,954 RGD:6480464
G Glul glutamate-ammonia ligase JBrowse link 13 71,331,052 71,340,207 RGD:6480464
G Gstm2 glutathione S-transferase mu 2 JBrowse link 2 210,778,041 210,782,807 RGD:6480464
G Havcr1 hepatitis A virus cellular receptor 1 JBrowse link 10 31,813,819 31,860,934 RGD:6480464
G Hmox1 heme oxygenase 1 JBrowse link 19 14,508,634 14,515,455 RGD:6480464
G Hmox2 heme oxygenase 2 JBrowse link 10 10,990,034 11,035,493 RGD:6480464
G Igfbp1 insulin-like growth factor binding protein 1 JBrowse link 14 87,448,716 87,453,783 RGD:6480464
G Igkc immunoglobulin kappa constant RGD:6480464
G Jun Jun proto-oncogene, AP-1 transcription factor subunit JBrowse link 5 114,011,184 114,014,277 RGD:6480464
G Klk1b3 kallikrein 1-related peptidase B3 JBrowse link 1 100,199,057 100,203,260 RGD:6480464
G Lcn2 lipocalin 2 JBrowse link 3 11,414,189 11,417,534 RGD:6480464
G Mgp matrix Gla protein JBrowse link 4 170,856,783 170,860,105 RGD:6480464
G Mt1 metallothionein 1 JBrowse link 19 11,301,991 11,303,007 RGD:6480464
G Nphs2 NPHS2 stomatin family member, podocin JBrowse link 13 73,929,136 73,941,522 RGD:6480464
G Oat ornithine aminotransferase JBrowse link 1 204,562,289 204,582,070 RGD:6480464
G Rgn regucalcin JBrowse link X 1,833,484 1,848,904 RGD:6480464
G Slc22a1 solute carrier family 22 member 1 JBrowse link 1 48,273,639 48,300,645 RGD:6480464
G Slc22a6 solute carrier family 22 member 6 JBrowse link 1 224,824,809 224,833,284 RGD:6480464
G Spp1 secreted phosphoprotein 1 JBrowse link 14 6,673,686 6,679,965 RGD:6480464
G Timp1 TIMP metallopeptidase inhibitor 1 JBrowse link X 1,364,771 1,369,451 RGD:6480464
G Tmsb10 thymosin, beta 10 JBrowse link 4 100,882,216 100,883,303 RGD:6480464
G Vcam1 vascular cell adhesion molecule 1 JBrowse link 2 219,071,193 219,090,931 RGD:6480464
G Vegfa vascular endothelial growth factor A JBrowse link 9 17,340,341 17,355,681 RGD:6480464
G Vim vimentin JBrowse link 17 80,882,715 80,891,200 RGD:6480464
beta-endorphin term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Crh corticotropin releasing hormone JBrowse link 2 104,459,999 104,461,863 RGD:6480464
G Il2 interleukin 2 JBrowse link 2 123,847,150 123,851,854 RGD:6480464
G Il4 interleukin 4 JBrowse link 10 38,963,979 38,969,531 RGD:6480464
G Mapk1 mitogen activated protein kinase 1 JBrowse link 11 88,203,863 88,273,301 RGD:6480464
G Mapk3 mitogen activated protein kinase 3 JBrowse link 1 198,192,773 198,198,975 RGD:6480464
G Nfkbia NFKB inhibitor alpha JBrowse link 6 76,267,227 76,270,457 RGD:6480464
G Pld2 phospholipase D2 JBrowse link 10 57,161,921 57,181,148 RGD:6480464
G Usp15 ubiquitin specific peptidase 15 JBrowse link 7 66,595,707 66,687,707 RGD:6480464
bivalirudin term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Crp C-reactive protein JBrowse link 13 91,080,448 91,081,358 RGD:6480464
G F2 coagulation factor II JBrowse link 3 80,529,468 80,542,993 RGD:6480464
G F2r coagulation factor II (thrombin) receptor JBrowse link 2 26,118,760 26,135,340 RGD:6480464
G F2rl3 F2R like thrombin or trypsin receptor 3 JBrowse link 16 18,817,797 18,819,790 RGD:6480464
G Mpo myeloperoxidase JBrowse link 10 75,087,892 75,098,260 RGD:6480464
G P2ry12 purinergic receptor P2Y12 JBrowse link 2 149,440,807 149,482,592 RGD:6480464
G Pdgfb platelet derived growth factor subunit B JBrowse link 7 121,215,458 121,233,092 RGD:6480464
G Selp selectin P JBrowse link 13 82,428,914 82,464,629 RGD:6480464
calcitonin term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Hcrt hypocretin neuropeptide precursor JBrowse link 10 88,669,216 88,670,430 RGD:6480464
G Pmch pro-melanin-concentrating hormone JBrowse link 7 28,655,206 28,656,522 RGD:6480464
corticotropin term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Ada adenosine deaminase JBrowse link 3 160,115,840 160,139,947 RGD:6480464
G Calca calcitonin-related polypeptide alpha JBrowse link 1 184,184,018 184,188,922 RGD:6480464
G Cnp 2',3'-cyclic nucleotide 3' phosphodiesterase JBrowse link 10 88,490,798 88,497,357 RGD:6480464
G Crh corticotropin releasing hormone JBrowse link 2 104,459,999 104,461,863 RGD:6480464
G Cyp17a1 cytochrome P450, family 17, subfamily a, polypeptide 1 JBrowse link 1 266,422,127 266,429,947 RGD:6480464
G Gh1 growth hormone 1 JBrowse link 10 94,486,204 94,488,181 RGD:6480464
G Htr2a 5-hydroxytryptamine receptor 2A JBrowse link 15 56,666,152 56,732,469 RGD:6480464
G Ins2 insulin 2 JBrowse link 1 215,856,967 215,858,034 RGD:6480464
G Nr3c1 nuclear receptor subfamily 3, group C, member 1 JBrowse link 18 31,728,373 32,704,022 RGD:6480464
G Ppp1r1b protein phosphatase 1, regulatory (inhibitor) subunit 1B JBrowse link 10 86,303,727 86,312,770 RGD:6480464
G Ucn2 urocortin 2 JBrowse link 8 117,727,216 117,728,765 RGD:6480464
corticotropin-releasing hormone term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Crhr1 corticotropin releasing hormone receptor 1 JBrowse link 10 92,191,473 92,233,662 RGD:6480464
cosyntropin term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Hsd11b2 hydroxysteroid 11-beta dehydrogenase 2 JBrowse link 19 37,476,083 37,481,326 RGD:6480464
enfuvirtide term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Cyp1a2 cytochrome P450, family 1, subfamily a, polypeptide 2 JBrowse link 8 62,451,360 62,458,244 RGD:6480464
G Cyp2c6v1 cytochrome P450, family 2, subfamily C, polypeptide 6, variant 1 JBrowse link 1 147,713,879 147,814,410 RGD:6480464
G Cyp2e1 cytochrome P450, family 2, subfamily e, polypeptide 1 JBrowse link 1 213,511,892 213,522,195 RGD:6480464
ganirelix term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Lhb luteinizing hormone subunit beta JBrowse link 1 101,409,992 101,413,725 RGD:6480464
gastrin-17 term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Birc2 baculoviral IAP repeat-containing 2 JBrowse link 8 6,014,014 6,036,668 RGD:6480464
G Birc3 baculoviral IAP repeat-containing 3 JBrowse link 8 6,048,590 6,076,828 RGD:6480464
G Cckbr cholecystokinin B receptor JBrowse link 1 170,262,218 170,272,298 RGD:6480464
G Ier3 immediate early response 3 JBrowse link 20 3,438,798 3,440,002 RGD:6480464
G Nfkb1 nuclear factor kappa B subunit 1 JBrowse link 2 240,773,520 240,890,053 RGD:6480464
G Rela RELA proto-oncogene, NF-kB subunit JBrowse link 1 220,992,770 221,003,249 RGD:6480464
G Sele selectin E JBrowse link 13 82,355,234 82,365,323 RGD:6480464
insulin (human) term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Tnf tumor necrosis factor JBrowse link 20 5,189,382 5,192,000 RGD:15023464
lepirudin term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G F2 coagulation factor II JBrowse link 3 80,529,468 80,542,993 RGD:6480464
liraglutide term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Akt1 AKT serine/threonine kinase 1 JBrowse link 6 137,218,398 137,239,970 RGD:6480464
G Bax BCL2 associated X, apoptosis regulator JBrowse link 1 101,451,801 101,457,207 RGD:6480464
G Bcl2 BCL2, apoptosis regulator JBrowse link 13 26,605,426 26,769,374 RGD:6480464
G Casp3 caspase 3 JBrowse link 16 48,845,011 48,863,249 RGD:6480464
G Glp1r glucagon-like peptide 1 receptor JBrowse link 20 9,586,075 9,626,228 RGD:6480464
G Gsk3b glycogen synthase kinase 3 beta JBrowse link 11 65,060,884 65,208,842 RGD:6480464
G Mapt microtubule-associated protein tau JBrowse link 10 92,289,002 92,386,517 RGD:6480464
G Sftpa1 surfactant protein A1 JBrowse link 16 18,716,019 18,719,404 RGD:6480464
G Sftpb surfactant protein B JBrowse link 4 100,166,855 100,175,941 RGD:6480464
mastoparan term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Abca1 ATP binding cassette subfamily A member 1 JBrowse link 5 69,857,717 69,983,042 RGD:6480464
G Apoa1 apolipoprotein A1 JBrowse link 8 50,525,091 50,526,875 RGD:6480464
G Calm1 calmodulin 1 JBrowse link 6 124,217,241 124,225,292 RGD:6480464
G Il6 interleukin 6 JBrowse link 4 3,043,231 3,047,807 RGD:6480464
G Nos1 nitric oxide synthase 1 JBrowse link 12 44,214,949 44,405,530 RGD:6480464
melittin term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Adam10 ADAM metallopeptidase domain 10 JBrowse link 8 77,107,355 77,237,483 RGD:6480464
G Adam17 ADAM metallopeptidase domain 17 JBrowse link 6 43,400,525 43,448,280 RGD:6480464
G Aim2 absent in melanoma 2 JBrowse link 13 91,919,834 91,963,080 RGD:6480464
G Akt1 AKT serine/threonine kinase 1 JBrowse link 6 137,218,398 137,239,970 RGD:6480464
G Alox5 arachidonate 5-lipoxygenase JBrowse link 4 148,398,004 148,446,308 RGD:6480464
G Apaf1 apoptotic peptidase activating factor 1 JBrowse link 7 31,699,309 31,784,192 RGD:6480464
G Bax BCL2 associated X, apoptosis regulator JBrowse link 1 101,451,801 101,457,207 RGD:6480464
G Bcl2 BCL2, apoptosis regulator JBrowse link 13 26,605,426 26,769,374 RGD:6480464
G Birc3 baculoviral IAP repeat-containing 3 JBrowse link 8 6,048,590 6,076,828 RGD:6480464
G Calm1 calmodulin 1 JBrowse link 6 124,217,241 124,225,292 RGD:6480464
G Casp3 caspase 3 JBrowse link 16 48,845,011 48,863,249 RGD:6480464
G Casp8 caspase 8 JBrowse link 9 65,614,142 65,662,624 RGD:6480464
G Casp9 caspase 9 JBrowse link 5 160,356,211 160,373,774 RGD:6480464
G Ccnd1 cyclin D1 JBrowse link 1 218,090,750 218,100,447 RGD:6480464
G Cdh1 cadherin 1 JBrowse link 19 38,768,467 38,838,395 RGD:6480464
G Cdk4 cyclin-dependent kinase 4 JBrowse link 7 70,345,971 70,352,689 RGD:6480464
G Chrna7 cholinergic receptor nicotinic alpha 7 subunit JBrowse link 1 123,897,341 124,039,263 RGD:6480464
G Chuk component of inhibitor of nuclear factor kappa B kinase complex JBrowse link 1 263,848,829 263,884,354 RGD:6480464
G Cryab crystallin, alpha B JBrowse link 8 55,178,543 55,182,546 RGD:6480464
G Drd2 dopamine receptor D2 JBrowse link 8 53,678,777 53,743,643 RGD:6480464
G Egfr epidermal growth factor receptor JBrowse link 14 99,919,485 100,104,136 RGD:6480464
G Fas Fas cell surface death receptor JBrowse link 1 252,589,785 252,624,790 RGD:6480464
G Fgf2 fibroblast growth factor 2 JBrowse link 2 124,081,072 124,134,133 RGD:6480464
G Fn1 fibronectin 1 JBrowse link 9 78,900,111 78,969,018 RGD:6480464
G Gap43 growth associated protein 43 JBrowse link 11 58,624,198 58,717,916 RGD:6480464
G Gli1 GLI family zinc finger 1 JBrowse link 7 70,620,794 70,633,171 RGD:6480464
G Gnrh1 gonadotropin releasing hormone 1 JBrowse link 15 44,441,856 44,446,064 RGD:6480464
G Hrh2 histamine receptor H 2 JBrowse link 17 10,912,959 10,931,389 RGD:6480464
G Htr1a 5-hydroxytryptamine receptor 1A JBrowse link 2 36,246,628 36,247,896 RGD:6480464
G Icam1 intercellular adhesion molecule 1 JBrowse link 8 22,035,287 22,047,049 RGD:6480464
G Ikbkb inhibitor of nuclear factor kappa B kinase subunit beta JBrowse link 16 74,177,233 74,230,809 RGD:6480464
G Il18 interleukin 18 JBrowse link 8 55,009,666 55,016,286 RGD:6480464
G Il1b interleukin 1 beta JBrowse link 3 121,876,256 121,882,637 RGD:6480464
G Il6 interleukin 6 JBrowse link 4 3,043,231 3,047,807 RGD:6480464
G Il6r interleukin 6 receptor JBrowse link 2 189,196,180 189,255,987 RGD:6480464
G Jak2 Janus kinase 2 JBrowse link 1 247,398,667 247,457,521 RGD:6480464
G Jun Jun proto-oncogene, AP-1 transcription factor subunit JBrowse link 5 114,011,184 114,014,277 RGD:6480464
G Kdr kinase insert domain receptor JBrowse link 14 34,727,677 34,787,127 RGD:6480464
G Lhcgr luteinizing hormone/choriogonadotropin receptor JBrowse link 6 12,493,182 12,554,482 RGD:6480464
G Mapk1 mitogen activated protein kinase 1 JBrowse link 11 88,203,863 88,273,301 RGD:6480464
G Mapk3 mitogen activated protein kinase 3 JBrowse link 1 198,192,773 198,198,975 RGD:6480464
G Mecp2 methyl CpG binding protein 2 JBrowse link X 156,650,389 156,713,813 RGD:6480464
G Mmp2 matrix metallopeptidase 2 JBrowse link 19 15,542,771 15,570,589 RGD:6480464
G Mmp3 matrix metallopeptidase 3 JBrowse link 8 5,676,608 5,698,579 RGD:6480464
G Mmp9 matrix metallopeptidase 9 JBrowse link 3 161,413,410 161,421,473 RGD:6480464
G Nfkb1 nuclear factor kappa B subunit 1 JBrowse link 2 240,773,520 240,890,053 RGD:6480464
G Nfkbia NFKB inhibitor alpha JBrowse link 6 76,267,227 76,270,457 RGD:6480464
G Nos1 nitric oxide synthase 1 JBrowse link 12 44,214,949 44,405,530 RGD:6480464
G Nos2 nitric oxide synthase 2 JBrowse link 10 66,188,290 66,221,621 RGD:6480464
G P2rx7 purinergic receptor P2X 7 JBrowse link 12 39,353,613 39,396,042 RGD:6480464
G Parp1 poly (ADP-ribose) polymerase 1 JBrowse link 13 98,857,255 98,889,444 RGD:6480464
G Pdgfrb platelet derived growth factor receptor beta JBrowse link 18 56,364,586 56,406,381 RGD:6480464
G Pla2g4a phospholipase A2 group IVA JBrowse link 13 67,062,252 67,206,688 RGD:6480464
G Plcg1 phospholipase C, gamma 1 JBrowse link 3 156,727,642 156,758,307 RGD:6480464
G Ptch1 patched 1 JBrowse link 17 1,032,242 1,085,885 RGD:6480464
G Ptgs2 prostaglandin-endoperoxide synthase 2 JBrowse link 13 67,351,230 67,356,920 RGD:6480464
G Rab11a RAB11a, member RAS oncogene family JBrowse link 8 70,192,975 70,215,719 RGD:6480464
G Rab5a RAB5A, member RAS oncogene family JBrowse link 9 5,910 6,065 RGD:6480464
G Rac1 Rac family small GTPase 1 JBrowse link 12 13,090,316 13,111,841 RGD:6480464
G Rela RELA proto-oncogene, NF-kB subunit JBrowse link 1 220,992,770 221,003,249 RGD:6480464
G Scn10a sodium voltage-gated channel alpha subunit 10 JBrowse link 8 128,298,593 128,416,896 RGD:6480464
G Scn11a sodium voltage-gated channel alpha subunit 11 JBrowse link 8 128,450,793 128,527,510 RGD:6480464
G Shh sonic hedgehog signaling molecule JBrowse link 4 718,538 727,691 RGD:6480464
G Slc6a3 solute carrier family 6 member 3 JBrowse link 1 32,323,011 32,363,983 RGD:6480464
G Stat3 signal transducer and activator of transcription 3 JBrowse link 10 88,790,401 88,842,263 RGD:6480464
G Tbxa2r thromboxane A2 receptor JBrowse link 7 11,253,153 11,259,233 RGD:6480464
G Tgfa transforming growth factor alpha JBrowse link 4 117,961,877 118,045,923 RGD:6480464
G Tgfb1 transforming growth factor, beta 1 JBrowse link 1 82,480,875 82,497,196 RGD:6480464
G Tnf tumor necrosis factor JBrowse link 20 5,189,382 5,192,000 RGD:6480464
G Tnfrsf10b tumor necrosis factor receptor superfamily, member 10b JBrowse link 15 51,433,853 51,464,215 RGD:6480464
G Tnfrsf21 TNF receptor superfamily member 21 JBrowse link 9 20,546,159 20,621,051 RGD:6480464
G Tnfrsf25 TNF receptor superfamily member 25 JBrowse link 5 169,288,419 169,293,137 RGD:6480464
G Trpv1 transient receptor potential cation channel, subfamily V, member 1 JBrowse link 10 59,799,123 59,824,208 RGD:6480464
G Vcam1 vascular cell adhesion molecule 1 JBrowse link 2 219,071,193 219,090,931 RGD:6480464
G Vegfa vascular endothelial growth factor A JBrowse link 9 17,340,341 17,355,681 RGD:6480464
G Xiap X-linked inhibitor of apoptosis JBrowse link X 128,409,425 128,455,786 RGD:6480464
Neurokinin A term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Tacr2 tachykinin receptor 2 JBrowse link 20 31,892,515 31,905,153 RGD:6480464
neurotensin term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Fos Fos proto-oncogene, AP-1 transcription factor subunit JBrowse link 6 109,300,433 109,303,299 RGD:6480464
G Fosl1 FOS like 1, AP-1 transcription factor subunit JBrowse link 1 220,826,560 220,835,066 RGD:6480464
G Junb JunB proto-oncogene, AP-1 transcription factor subunit JBrowse link 19 26,092,972 26,094,756 RGD:6480464
G Nfkb1 nuclear factor kappa B subunit 1 JBrowse link 2 240,773,520 240,890,053 RGD:6480464
G Ntsr1 neurotensin receptor 1 JBrowse link 3 175,982,313 176,046,345 RGD:6480464
G Ntsr2 neurotensin receptor 2 JBrowse link 6 41,917,065 41,923,780 RGD:6480464
G Rela RELA proto-oncogene, NF-kB subunit JBrowse link 1 220,992,770 221,003,249 RGD:6480464
nociceptin term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Oprl1 opioid related nociceptin receptor 1 JBrowse link 3 177,223,779 177,231,663 RGD:6480464
omega-conotoxin GVIA term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Clu clusterin JBrowse link 15 42,626,612 42,665,858 RGD:6480464
G Fos Fos proto-oncogene, AP-1 transcription factor subunit JBrowse link 6 109,300,433 109,303,299 RGD:6480464
G Kcna1 potassium voltage-gated channel subfamily A member 1 JBrowse link 4 159,190,781 159,192,526 RGD:6480464
G Kcnc3 potassium voltage-gated channel subfamily C member 3 JBrowse link 1 100,593,453 100,607,874 RGD:6480464
G Sct secretin JBrowse link 1 214,264,865 214,277,437 RGD:6480464
G Snca synuclein alpha JBrowse link 4 90,782,412 90,883,236 RGD:6480464
G Tac1 tachykinin, precursor 1 JBrowse link 4 33,638,853 33,646,819 RGD:6480464
PR-39 term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Icam1 intercellular adhesion molecule 1 JBrowse link 8 22,035,287 22,047,049 RGD:6480464
G Sele selectin E JBrowse link 13 82,355,234 82,365,323 RGD:6480464
G Tnf tumor necrosis factor JBrowse link 20 5,189,382 5,192,000 RGD:6480464
G Vcam1 vascular cell adhesion molecule 1 JBrowse link 2 219,071,193 219,090,931 RGD:6480464
royal jelly term browser
Symbol Object Name JBrowse Chr Start Stop Reference
G Bcl2 BCL2, apoptosis regulator JBrowse link 13 26,605,426 26,769,374 RGD:6480464
G Casp3 caspase 3 JBrowse link 16 48,845,011 48,863,249 RGD:6480464
G Cat catalase JBrowse link 3 93,379,872 93,412,058 RGD:6480464
G Esr1 estrogen receptor 1 JBrowse link 1 41,192,029 41,594,799 RGD:6480464
G Esr2 estrogen receptor 2 JBrowse link 6 99,163,953 99,214,711 RGD:6480464
G Pcna proliferating cell nuclear antigen JBrowse link 3 124,880,698 124,884,570 RGD:6480464
G Tff1 trefoil factor 1 JBrowse link 20 9,892,124 9,895,984 RGD:6480464
G Tp53 tumor protein p53 JBrowse link 10 56,186,299 56,198,449 RGD:6480464
G Vegfa vascular endothelial growth factor A JBrowse link 9 17,340,341 17,355,681 RGD:6480464

Term paths to the root
Path 1
Term Annotations click to browse term
  CHEBI ontology 19745
    chemical entity 19743
      molecular entity 19740
        polyatomic entity 19649
          macromolecule 3204
            polypeptide 184
              (12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
              (3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
              (4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 0
              Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
              Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 0
              Arthrofactin 0
              CIGB-300 0
              DASKALRSSGMP 0
              DKATIGFEVQEE 0
              DSGEGDFLAEGGGVR 0
              ENPAVHFFKNIVTPRTP 0
              ENPVVAFFKNIVTPRTP 0
              ENPVVHFFFNIVTPRTP 0
              ENPVVHFFKNIVTPRTP 0
              ENPVVHFFYNIVTPRTP 0
              FPAWFTKLYPRT 0
              Gonadorelin hydrochloride 0
              IPQVWRDWFKLP 0
              JNK inhibitor I 0
              KGKGKGKGKGENPAVHFFKNIVTPRTP 0
              KGKGKGKGKGENPVVAFFKNIVTPRTP 0
              KGKGKGKGKGENPVVHFFFNIVTPRTP 0
              KGKGKGKGKGENPVVHFFKNIVTPRTP 0
              KGKGKGKGKGENPVVHFFYNIVTPRTP 0
              LSM-37009 0
              LSM-37015 0
              LSM-37045 0
              LSM-37094 0
              LSM-37129 0
              LSM-37138 0
              LSM-37175 0
              LSM-37192 0
              LSM-37213 0
              Mirabamide C 0
              Mirabamide G 0
              Mirabamide H 0
              N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 0
              N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
              Nafarelin 0
              Nafarelin acetate hydrate 0
              Neurokinin A 1
              Neurokinin B 0
              P-factor 0
              PR-39 4
              QINTAKWWKTHF 0
              QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 0
              STAT3 inhibitor peptide 0
              Sermorelin 0
              Streptomyces coelicolor calcium-dependent antibiotic CDA4b 0
              VSWKTWFPNLAV 0
              Vaby A 0
              Vaby B 0
              Vaby C 0
              Vaby D 0
              Vaby E 0
              Varv E 0
              WHWLQLKPGQPMY 0
              YIIKGLFWDPAC + 0
              YIIKGVFWDPAC + 0
              YSPFHKWFPSMH 0
              abarelix 0
              afamelanotide 1
              albiglutide 0
              amoxicilloyl polylysine 0
              amyloid-beta + 0
              astressin 7
              astressin 2B 6
              bacitracin A + 45
              benzylpenicilloyl polylysine 0
              beta-endorphin 8
              bivalirudin 8
              calcitonin 2
              calcitonin (human synthetic) 0
              calcitonin (pork natural) 0
              calpastatin peptide Ac 184-210 0
              carperitide 0
              corticorelin 0
              corticotropin 11
              corticotropin-releasing hormone + 1
              cosyntropin 1
              cyanophycin macromolecule + 0
              defensin + 0
              degarelix 0
              dermaseptin s3(1-16)-NH2 0
              desirudin 0
              elcatonin 0
              elf18 0
              enfuvirtide 3
              exendin-3 0
              exendin-4 0
              ganirelix 1
              gastrin + 7
              ghrelin 0
              insulin + 0
              kisspeptin-54 0
              koshikamide A2 0
              lantibiotic + 0
              lepirudin 1
              liraglutide 9
              lixisenatide 0
              mastoparans + 5
              melittin 76
              nesiritide 0
              neurotensin 7
              nociceptin 1
              omega-conotoxin GVIA 7
              p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 0
              penicilloyl polylysine 0
              peptide YY 0
              poly(glycyl-L-arginine) 0
              pramlintide 0
              protein polypeptide chain + 9
              secretin human 0
              teduglutide 0
              teriparatide 0
              terlipressin 0
              tesamorelin 0
              thymalfasin 0
Path 2
Term Annotations click to browse term
  CHEBI ontology 19745
    subatomic particle 19741
      composite particle 19741
        hadron 19741
          baryon 19741
            nucleon 19741
              atomic nucleus 19741
                atom 19741
                  main group element atom 19625
                    p-block element atom 19625
                      carbon group element atom 19519
                        carbon atom 19513
                          organic molecular entity 19513
                            organic group 18424
                              organic divalent group 18416
                                organodiyl group 18416
                                  carbonyl group 18304
                                    carbonyl compound 18304
                                      carboxylic acid 17970
                                        carboacyl group 17080
                                          univalent carboacyl group 17080
                                            carbamoyl group 16809
                                              carboxamide 16809
                                                peptide 9320
                                                  polypeptide 184
                                                    (12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
                                                    (3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
                                                    (4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 0
                                                    Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
                                                    Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
                                                    Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 0
                                                    Arthrofactin 0
                                                    CIGB-300 0
                                                    DASKALRSSGMP 0
                                                    DKATIGFEVQEE 0
                                                    DSGEGDFLAEGGGVR 0
                                                    ENPAVHFFKNIVTPRTP 0
                                                    ENPVVAFFKNIVTPRTP 0
                                                    ENPVVHFFFNIVTPRTP 0
                                                    ENPVVHFFKNIVTPRTP 0
                                                    ENPVVHFFYNIVTPRTP 0
                                                    FPAWFTKLYPRT 0
                                                    Gonadorelin hydrochloride 0
                                                    IPQVWRDWFKLP 0
                                                    JNK inhibitor I 0
                                                    KGKGKGKGKGENPAVHFFKNIVTPRTP 0
                                                    KGKGKGKGKGENPVVAFFKNIVTPRTP 0
                                                    KGKGKGKGKGENPVVHFFFNIVTPRTP 0
                                                    KGKGKGKGKGENPVVHFFKNIVTPRTP 0
                                                    KGKGKGKGKGENPVVHFFYNIVTPRTP 0
                                                    LSM-37009 0
                                                    LSM-37015 0
                                                    LSM-37045 0
                                                    LSM-37094 0
                                                    LSM-37129 0
                                                    LSM-37138 0
                                                    LSM-37175 0
                                                    LSM-37192 0
                                                    LSM-37213 0
                                                    Mirabamide C 0
                                                    Mirabamide G 0
                                                    Mirabamide H 0
                                                    N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 0
                                                    N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
                                                    Nafarelin 0
                                                    Nafarelin acetate hydrate 0
                                                    Neurokinin A 1
                                                    Neurokinin B 0
                                                    P-factor 0
                                                    PR-39 4
                                                    QINTAKWWKTHF 0
                                                    QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 0
                                                    STAT3 inhibitor peptide 0
                                                    Sermorelin 0
                                                    Streptomyces coelicolor calcium-dependent antibiotic CDA4b 0
                                                    VSWKTWFPNLAV 0
                                                    Vaby A 0
                                                    Vaby B 0
                                                    Vaby C 0
                                                    Vaby D 0
                                                    Vaby E 0
                                                    Varv E 0
                                                    WHWLQLKPGQPMY 0
                                                    YIIKGLFWDPAC + 0
                                                    YIIKGVFWDPAC + 0
                                                    YSPFHKWFPSMH 0
                                                    abarelix 0
                                                    afamelanotide 1
                                                    albiglutide 0
                                                    amoxicilloyl polylysine 0
                                                    amyloid-beta + 0
                                                    astressin 7
                                                    astressin 2B 6
                                                    bacitracin A + 45
                                                    benzylpenicilloyl polylysine 0
                                                    beta-endorphin 8
                                                    bivalirudin 8
                                                    calcitonin 2
                                                    calcitonin (human synthetic) 0
                                                    calcitonin (pork natural) 0
                                                    calpastatin peptide Ac 184-210 0
                                                    carperitide 0
                                                    corticorelin 0
                                                    corticotropin 11
                                                    corticotropin-releasing hormone + 1
                                                    cosyntropin 1
                                                    cyanophycin macromolecule + 0
                                                    defensin + 0
                                                    degarelix 0
                                                    dermaseptin s3(1-16)-NH2 0
                                                    desirudin 0
                                                    elcatonin 0
                                                    elf18 0
                                                    enfuvirtide 3
                                                    exendin-3 0
                                                    exendin-4 0
                                                    ganirelix 1
                                                    gastrin + 7
                                                    ghrelin 0
                                                    insulin + 0
                                                    kisspeptin-54 0
                                                    koshikamide A2 0
                                                    lantibiotic + 0
                                                    lepirudin 1
                                                    liraglutide 9
                                                    lixisenatide 0
                                                    mastoparans + 5
                                                    melittin 76
                                                    nesiritide 0
                                                    neurotensin 7
                                                    nociceptin 1
                                                    omega-conotoxin GVIA 7
                                                    p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 0
                                                    penicilloyl polylysine 0
                                                    peptide YY 0
                                                    poly(glycyl-L-arginine) 0
                                                    pramlintide 0
                                                    protein polypeptide chain + 9
                                                    secretin human 0
                                                    teduglutide 0
                                                    teriparatide 0
                                                    terlipressin 0
                                                    tesamorelin 0
                                                    thymalfasin 0
paths to the root

NHLBI Logo

RGD is funded by grant HL64541 from the National Heart, Lung, and Blood Institute on behalf of the NIH.