Submit Data |  Help |  Video Tutorials |  News |  Publications |  FTP Download |  REST API |  Citing RGD |  Contact   

Ontology Browser

Term:
(2E)-4-hydroxy-3-methylbut-2-en-1-yl diphosphate (CHEBI:15664)
Annotations: Rat: (0) Mouse: (0) Human: (0) Chinchilla: (0) Bonobo: (0) Dog: (0) Squirrel: (0) Pig: (0)
Parent Terms Term With Siblings Child Terms
(-)-ureidoglycolic acid 
(1R,2S,5S,6S)-2-(3-carboxypropanoyl)-5-[(1-carboxyvinyl)oxy]-6-hydroxycyclohex-3-ene-1-carboxylic acid 
(2E)-3-(methoxycarbonyl)pent-2-enedioic acid 
(2E)-4-hydroxy-3-methylbut-2-en-1-yl diphosphate 
A prenol phosphate comprising (2E)-4-hydroxy-3-methylbut-2-en-1-ol having an O-diphosphate substituent.
(2E)-4-hydroxy-3-methylbut-2-enyl diphosphate(3-) 
(2S)-2-hydroxy-2-methyl-3-oxobutanoic acid 
(2S,3R)-3-hydroxybutane-1,2,3-tricarboxylic acid 
(2S,6S)-2,6-diaminopimelic acid dizwitterion 
(4-hydroxyphenyl)acetaldehyde 
(4S)-2-methylpentane-2,4-diol 
(4Z)-2,8:7,12:11,15:14,18:17,22-pentaanhydro-4,5,6,9,10,13,19,20,21-nonadeoxy-L-arabino-L-allo-L-allo-docosa-4,9,20-trienitol 
(6R)-5,10-methenyltetrahydrofolic acid 
(6R)-5,10-methylenetetrahydrofolic acid +  
(E)-hexadec-2-enoyl-CoA 
(KDO)-lipid IVA 
(KDO)2-(lauroyl)-lipid IVA 
(Kdo)2-lipid A (E. coli) +  
(KDO)2-lipid IVA 
(N(omega)-L-arginino)succinic acid  
(R)-3-hydroxy-2-oxo-4-phosphonooxybutanoic acid 
(R)-4'-phosphopantothenic acid 
(R)-lactaldehyde 
(R)-lactic acid +   
(R)-propane-1,2-diol 
(R)-S-lactoylglutathione 
(S)-2-(4-nitrobenzyl)-DOTA 
(S)-2-\{4-[2-(2-hydroxyethylthio)acetamido]benzyl\}-DOTA 
(S)-3-hydroxybutanoyl-CoA 
(S)-3-hydroxyhexanoyl-CoA 
(S)-3-hydroxylauroyl-CoA 
(S)-3-hydroxyoctanoyl-CoA 
(S)-3-hydroxypalmitoyl-CoA 
(S)-3-hydroxytetradecanoyl-CoA 
(S)-4,5-dihydroxypentane-2,3-dione 
(S)-4-amino-5-oxopentanoic acid 
(S)-dihydroorotic acid 
(S)-lactaldehyde 
(S)-lactic acid +   
(S)-methylmalonyl-CoA 
(S)-propane-1,2-diol +  
(Z)-but-2-ene-1,2,3-tricarboxylic acid 
(Z)-hexadec-11-enal 
->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)]-beta-D-Galp-yl group 
->4)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
->8)-alpha-Neu5Ac-(2->3)-[beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)]-beta-D-Gal-(1->4)-yl group +   
1,2,4-butanetriol 
1,2-di-O-[1-(14)C]-palmitoyl-sn-glycero-3-phosphocholine 
1,2-di-O-palmitoyl-sn-glycero-3-phosphocholine 
1,4-dihydroxy-2-naphthoate 
1,4-dihydroxy-2-naphthoic acid +   
1,4-dihydroxy-2-naphthoyl-CoA 
1,6:5,9:8,12:11,16-tetraanhydro-2,3,4,10,13,14-hexadeoxy-D-glycero-D-allo-D-gulo-heptadeca-2,13-dienitol 
1,7,8,9,10,10-hexachloro-4-methyl-4-azatricyclo[5.2.1.0(2,6)]dec-8-ene-3,5-dione 
1-(2-carboxyphenylamino)-1-deoxy-D-ribulose 5-phosphate 
1-(3,6-di-O-sulfo-beta-D-galactosyl)-N-lauroylsphingosine 
1-(3-O-sulfo-beta-D-galactosyl)-N-[(15Z)-tetracos-15-enoyl]sphingosine 
1-(3-O-sulfo-beta-D-galactosyl)-N-stearoylsphingosine 
1-(5-phospho-beta-D-ribosyl)-5'-AMP 
1-(5-phospho-beta-D-ribosyl)-5-[(5-phospho-beta-D-ribosylamino)methylideneamino]imidazole-4-carboxamide 
1-(sn-glycero-3-phospho)-1D-myo-inositol 
1-acyl-sn-glycero-3-phosphoethanolamine +  
1-acyl-sn-glycerol 3-phosphate +  
1-aminopropan-2-ol +  
1-chloro-2,4,6-trinitrobenzene  
1-chloro-2,4-dinitrobenzene  
1-deoxy-D-xylulose 
1-deoxy-D-xylulose 5-phosphate 
1-dodecylpyrrolidin-2-one 
1-elaidoyl-sn-glycero-3-phosphocholine 
1-O-(1-O-hexadecanoyl-2-O-heptadecanoyl-sn-glycero-3-phosphono)-1D-myo-inositol 
1-O-(alpha-D-galactopyranosyl)-N-hexacosanoylsphinganine 
1-O-(alpha-D-galactopyranosyl)-N-pamitoylphytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-tetracosanyl-2-aminononane-1,3,4-triol 
1-O-(alpha-D-galactopyranuronosyl)-N-tetradecanoyldihydrosphingosine 
1-O-(alpha-D-galactosyl)-N-hexacosanoylphytosphingosine +   
1-O-[6-O-(3-phenylpropanoyl)-alpha-D-galactopyranosyl]-N-hexacosanoylsphinganine 
1-O-[6-O-(3-phenylpropanoyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-dodecanoyl-2-O-pentacosanoyl-sn-glycero-3-phosphocholine 
1-O-palmitoyl-2-O-[1-(14)C]-linoleoyl-sn-glycero-3-phosphocholine 
10-formyltetrahydrofolic acid +   
15-acetyldeoxynivalenol  
15-dehydroprostaglandin A1 
17beta-estradiol 6-O-(carboxymethyl)oxime 
1D-myo-inositol 1,2-cyclic phosphate 
1D-myo-inositol 1-phosphate  
1H-indole +   
2',3'-cyclic AMP 
2',3'-cyclic CMP 
2',3'-cyclic GMP +  
2',3'-cyclic UMP 
2'-deoxyadenosine +   
2'-deoxycytidine +   
2'-deoxycytosine 5'-monophosphate +   
2'-deoxyguanosine +   
2'-deoxyguanosine 5'-monophosphate +   
2'-deoxyinosine 
2'-deoxyinosine-5'-diphosphate 
2'-deoxyinosine-5'-monophosphate 
2'-deoxyuridine +  
2,3,2',3'-tetrakis(3-hydroxytetradecanoyl)-alpha-D-glucosaminyl-1,6-beta-D-glucosamine 1-phosphate +  
2,3,4,5-tetrahydrodipicolinic acid +  
2,3-bis-O-(geranylgeranyl)-sn-glycero-3-phosphoethanolamine 
2,3-dihydroxy-trans-cinnamic acid 
2,3-dihydroxybenzoyl 5'-adenylate 
2,3-diketogulonic acid 
2,4,6-trinitrobenzenesulfonic acid  
2,4,6-trinitrophenyl group +  
2,4-dinitrophenyl group +  
2,5-didehydro-D-gluconic acid 
2,6-di-O-(alpha-D-mannosyl)-1-O-(1,2-di-O-hexadecanoyl-sn-glycero-3-phosphono)-1D-myo-inositol 
2,6-diaminopimelate(2-) +  
2,6-diaminopimelic acid +  
2-(acetylamino)naphthalene-1,5-disulfonic acid 
2-(alpha-D-mannosyl)-D-glyceric acid +  
2-\{[(R)-\{[4-(aminomethyl)phenyl]amino\}\{[(1R)-1-phenylethyl]amino\}methyl]amino\}ethane-1,1-diol 
2-acetamido-2-deoxy-D-glucopyranose 1-phosphate +  
2-acetamidofluorene +   
2-acyl-sn-glycero-3-phosphate +  
2-acyl-sn-glycero-3-phosphoethanolamine +  
2-amino-2-deoxy-beta-D-galactopyranose 
2-amino-2-deoxy-D-glucopyranose +   
2-aminoacetaldehyde 
2-C-methyl-D-erythritol 2,4-cyclic diphosphate 
2-C-methyl-D-erythritol 4-(dihydrogen phosphate) 
2-dehydro-3-deoxy-6-phospho-D-gluconic acid 
2-dehydro-3-deoxy-D-galactonic acid 
2-dehydro-3-deoxy-D-gluconic acid 
2-demethylmenaquinone +  
2-deoxy-D-glucose 6-phosphate 
2-endo-amino-2-exo-benzoyl-3-exo-phenylnorbornane 
2-formamido-N(1)-(5-phospho-D-ribosyl)acetamidine 
2-hydroxy-3-oxobutyl phosphate +  
2-hydroxy-3-oxopropanoic acid 
2-isopropylmaleic acid 
2-methoxy-6-(all-trans-octaprenyl)phenol 
2-octaprenylphenol 
2-phenylethanaminium 
2-phenylethylamine +   
2-phospho-D-glyceric acid 
2-phosphoglycolic acid 
2-trans,6-trans-farnesyl diphosphate +   
24G7 epitope +   
3',4'-O-disulfo-N-acetyllactosamine 
3',5'-cyclic AMP +   
3',5'-cyclic GMP +   
3'-AMP 
3'-CMP  
3'-dephospho-CoA 
3'-phospho-5'-adenylyl sulfate  
3'-UMP +  
3,3-dimethylcystein-S-yl group 
3,4-di-O-methyl-alpha-L-rhamnose 
3,4-dichloroaniline +   
3,4-dihydroxyphenylacetaldehyde  
3,6-di-O-sulfo-beta-D-galactosyl-(1->4)-6-O-sulfo-N-acetyl-beta-D-glucosamine 
3,6-di-O-sulfo-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
3-(3-hydroxyphenyl)propanoic acid +  
3-(all-trans-octaprenyl)benzene-1,2-diol 
3-(imidazol-4-yl)-2-oxopropyl dihydrogen phosphate 
3-(imidazol-5-yl)lactic acid +  
3-\{[(5-nitrofuran-2-yl)methylidene]amino\}-1,3-oxazol-2-one 
3-acetyldeoxynivalenol  
3-aminoalanine +  
3-cyano-L-alanine +  
3-dehydro-L-gulonic acid +  
3-dehydro-L-gulonic acid 6-phosphate 
3-dehydroquinic acid 
3-hydroxydecanoic acid 
3-hydroxyoctadecanoyl-CoA +  
3-hydroxypropionic acid +   
3-hydroxypyruvic acid  
3-mercaptopyruvic acid 
3-O-\{(1R)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl\}-2,6-bis-O-\{(1S)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl\}-beta-D-Man-(1->4) -beta-D-GlcNAc-(1->4)-3-O-[(1S)-2-hydroxy-1-\{[(2S)-1-hydroxypropan-2-yl]oxy\}ethyl]-D-GlcNAc-yl group 
3-O-alpha-abequopyranosyl-alpha-D-mannopyranose 
3-O-methyl-alpha-L-rhamnose 
3-O-sulfo-beta-D-galactose +  
3-oxo-N-[(3S)-2-oxopyrrolidin-3-yl]dodecanamide 
3-oxoadipyl-CoA 
3-oxodecanoyl-CoA 
3-oxohexanoyl-CoA 
3-oxolauroyl-CoA 
3-oxooctadecanoyl-CoA 
3-oxooctanoyl-CoA 
3-oxopalmitoyl-[acyl-carrier protein] 
3-oxopalmitoyl-CoA 
3-oxotetradecanoyl-CoA 
3-phospho-D-glyceric acid 
3-phospho-D-glyceroyl dihydrogen phosphate 
3-phosphoshikimic acid 
3-sulfino-L-alanine +  
4,6-di-O-sulfo-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp2Me-(1->2)-4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-ManpOMe 
4-(18,20-dihydroxy-26-methoxy-25-methyloctacosyl)phenyl 3,6-di-O-methyl-beta-D-Glc-(1->4)-2,3-di-O-methyl-alpha-L-Rha-(1->2)-3-O-methyl-alpha-L-Rha 
4-(2-carboxyphenyl)-4-oxobutanoyl-CoA 
4-(4-styrylphenylcarbamoyl)butyric acid 
4-(\{5-[(2-aminoethyl)amino]-2,4-dinitrophenyl\}amino)-TEMPO 
4-(L-gamma-glutamylamino)butanoic acid 
4-(phosphonooxy)-L-threonine 
4-(trimethylammonio)butanoate  
4-(trimethylammonio)butanoic acid +  
4-[(1S,2R)-3-(4-fluorophenyl)-2-hydroxy-1-(1,2,4-triazol-1-yl)propyl]benzonitrile 
4-[N'-(2-hydroxyethyl)thioureido]-L-benzyl EDTA 
4-amino-2-methyl-5-diphosphooxymethylpyrimidine 
4-amino-2-methyl-5-phosphooxymethylpyrimidine 
4-amino-5-hydroxymethyl-2-methylpyrimidine 
4-aminobenzoate 
4-aminobenzoic acid +   
4-aminobutanal 
4-aminobutyl beta-D-xylopyranoside 
4-CDP-2-C-methyl-D-erythritol 
4-CDP-2-C-methyl-D-erythritol 2-phosphate 
4-hydroxy-2-oxopentanoic acid +  
4-hydroxy-L-threonine 
4-methyl-1,4-dihydropyridine-3,5-dicarbaldehyde 
4-methyl-5-(2-phosphonooxyethyl)thiazole +  
4-nitrophenyl (4-carboxybutyl)phosphonate 
4-nitrophenyl methylphosphonate 
4-O-(2-acetamido-2-deoxy-beta-D-glucopyranosyl)-5-O-phosphono-D-ribitol 
4-O-(2-acetamido-2-deoxy-beta-D-glucopyranosyl)-D-ribitol +  
4-O-acetyl-2,3-di-O-methyl-alpha-L-fucopyranose 
4-phospho-D-erythronic acid 
4-phospho-L-aspartic acid +  
4-pregnen-20,21-diol-3-one 
5'-adenylyl sulfate +   
5'-CGAAAGUCCGAUCGGCGUAAUGUCA-3' RNA fragment 
5'-CGTGCTGTTTTTTTTTG-3' 
5'-CGUUCGCG-3' RNA fragment 
5'-deoxyadenosine 
5'-GACCCCUG-3' RNA fragment 
5'-GUUUGGCGACGUCCCACAUGAGCC-3' RNA fragment 
5'-S-methyl-5'-thioadenosine  
5'-TCGAGCTGCCTTCAGTCGT-3' 
5'-xanthylic acid +  
5,6,7,8-tetrahydropteridine 
5,6-dihydrouracil 
5,6-dimethylbenzimidazole 
5-(2-amino-5,6-dimethyl-1H-benzimidazol-1-yl)pentanoic acid 
5-(2-hydroxyethyl)-4-methylthiazole 
5-(\{4-[2-(1-oxidopiperidin-1-yl)ethyl]phenyl\}amino)-5-oxopentanoic acid 
5-[(4,6-diamino-1,3,5-triazin-2-yl)amino]-4-hydroxy-3-[(2-sulfophenyl)diazenyl]naphthalene-2,7-disulfonic acid 
5-[(4-nitrobenzyl)(phosphonomethyl)amino]valeric acid 
5-[(5-phospho-1-deoxy-D-ribulos-1-ylimino)methylamino]-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide 
5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylic acid 
5-amino-2-chlorobenzotrifluoride 
5-amino-6-(5-phospho-beta-D-ribosylamino)uracil 
5-amino-6-(5-phospho-D-ribitylamino)uracil 
5-amino-6-(D-ribitylamino)uracil 
5-aminolevulinic acid +   
5-carboxyamino-1-(5-phospho-D-ribosyl)imidazole 
5-dehydro-D-gluconic acid 
5-formamido-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide 
5-formyltetrahydrofolic acid +   
5-O-(1-carboxyvinyl)-3-phosphoshikimic acid 
5-O-phosphono-alpha-D-ribofuranosyl diphosphate 
5-phospho-beta-D-ribosylamine 
6,7-dimethyl-8-(1-D-ribityl)lumazine 
6-(alpha-D-glucosaminyl)-1D-myo-inositol 1,2-cyclic phosphate 
6-[(1,2-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1,3-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1,4-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1,5-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1-deoxy-D-ribityl)methyl]-5-[(1E)-3-oxobut-1-en-1-yl]uracil 
6-[(2-hydroxyethyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(3-hydroxypropyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(4-aminobenzyl)amino]-2,3,4,5-tetrahydropyridinium 
6-[(4-hydroxybutyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(5-hydroxypentyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-\{4-[hydroxy-(4-nitrophenoxy)phosphoryl]butyrylamino\}hexanoic acid 
6-deoxy-alpha-L-Talp2,3Ac2-(1->3)-beta-D-Glcp-yl group 
6-deoxy-alpha-L-Talp2Ac3Me-(1->3)-beta-D-Glcp-yl group 
6-methyl-5-[(1E)-3-oxobut-1-en-1-yl]uracil 
6-O-phosphono-D-glucono-1,5-lactone 
6-phospho-2-dehydro-3-deoxy-D-galactonic acid 
7,8-dihydroneopterin +  
7,8-dihydroneopterin 3'-phosphate 
7,8-dihydroneopterin 3'-triphosphate 
7,9-dihydro-1H-purine-2,6,8(3H)-trione +   
7-cyano-7-deazaguanine 
7-phospho-2-dehydro-3-deoxy-D-arabino-heptonic acid 
8-(2-hydroxyethyl)-6-methyllumazine 
8-benzyl-7-hydroxy-4,10-dioxo-1-phenyl-6-oxa-3,9-diaza-7-phosphatetradecan-14-oic acid 7-oxide 
8-phospho-3-deoxy-D-manno-oct-2-ulosonic acid 
9-deoxy-9-acetamido-alpha-N-acetylneuraminyl-(2->6)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
9-deoxy-9-acetamido-N-acetyl-alpha-neuraminic acid 
9-mercaptodethiobiotin 
[3)-6-deoxy-alpha-L-Talp-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp2,4Ac2-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp2Ac-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp2Me-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp4Ac2Me-(1->3)-beta-D-Glcp-(1->]n 
[3)-alpha-D-Galp-(1->3)-beta-D-Galf2Ac-(1->]n 
[3)-beta-D-Glcp-(1->]5 
[3)-beta-D-Glcp6,NAc2-(1->] residue 
[3)-beta-D-GlcpNAc-(1->4)-alpha-L-Rhap-(1->]n 
[4)-alpha-D-GalNAcAN-(1->4)-alpha-D-GalNAcAN-(1->3)-beta-D-QuiNAc-(1->2)-beta-D-QuiN4Fm-(1->4)-alpha-D-GalNAcAN-(1->4)-alpha-D-GalNAcAN-(1->]n 
[4)-alpha-D-Galp-(1->3)-beta-D-Galf-(1->]n 
[4)-alpha-D-Glcp-(1->4)-alpha-D-Glcp-(1->4)-alpha-D-Glcp-(1->] residue 
[4)-beta-D-Galp-(1->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->]n 
[N-(4-cyanophenyl)-N'-(diphenylmethyl)guanidine]acetic acid  
acenaphthoquinone  
acetaldehyde +   
acetoacetyl-[acp] 
acetoacetyl-CoA  
acetyl dihydrogen phosphate 
acetyl phosphate(1-) 
acetyl-[acyl-carrier protein] 
adenine +   
adenosine 3',5'-bismonophosphate +   
adenosylcobinamide 
adenosylcobinamide guanosyl diphosphate 
adenosylcobinamide phosphate 
ADP alpha-D-glucoside 
ADP-D-glycero-D-manno-heptose +  
ADP-D-ribose +   
ADP-L-glycero-D-manno-heptose +  
aerobactin 
agmatine +   
AICA ribonucleotide  
Ala-tRNA(Ala) 
aldehydo-D-arabinose 5-phosphate(2-) 
all-trans-octaprenyl diphosphate 
allantoin +   
allolactose +  
alpha,alpha-trehalose +   
alpha,alpha-trehalose 6-phosphate 
alpha-(1->3)-galactobiose +  
alpha-D-Abep-(1->3)-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-D-GlcNAc +  
alpha-D-Gal-(1->3)-beta-D-Gal-(1->3)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-galactosaminyl-(1->3)-[alpha-L-fucosyl-(1->2)]-beta-D-galactosyl derivative(1+) 
alpha-D-galactose 1-phosphate  
alpha-D-galactosyl-(1->2)-alpha-D-galactose 
alpha-D-galactosyl-(1->2)-beta-D-galactose +  
alpha-D-galactosyl-(1->2)-D-galactose +  
alpha-D-galactosyl-(1->2)-D-galactosyl group 
alpha-D-galactosyl-(1->3)-D-galactose +  
alpha-D-galactosyl-(1->3)-D-galactosyl group 
alpha-D-galactosyl-(1->4)-beta-D-galactosyl group +  
alpha-D-GalNAc-(1->2)-beta-D-Man-(1->4)-[beta-D-Glc-(1->2)]-alpha-D-Man-(1->5)-alpha-Kdo 
alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-GalNpAc-(1->3)-beta-D-GalpNAc 
alpha-D-Galp-(1->2)-[alpha-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp 
alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-D-Galp-(1->2)-[alpha-D-Tyvp-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-D-Tyvp-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-D-Galp-(1->3)-[alpha-D-Galp-(1->4)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group 
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group +  
alpha-D-Galp-(1->3)-beta-D-Manp 
alpha-D-Galp-(1->4)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-D-Galp-(1->4)-beta-D-GalpNAc-(1->3)-D-Galp 
alpha-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GalpN-(1->4)-alpha-D-GalpA-yl group 
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-yl group +  
alpha-D-GalpNAc-(1->3)-beta-D-Galp +  
alpha-D-GalpNAc-(1->4)-[alpha-D-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Glcp-(1->3)-alpha-L-Rhap 
alpha-D-Glcp-(1->6)-alpha-D-Glcp-(1->6)-beta-D-Glcp +  
alpha-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->3)-D-GalpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-glucosamine 1-phosphate +  
alpha-D-glucose 1,6-bisphosphate 
alpha-D-glucose 1,6-bisphosphate(4-) 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc-4P-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo 
alpha-D-Kdo-(2->8)-[alpha-D-Kdo-(2->4)]-alpha-D-Kdo-(2->4)-alpha-D-Kdo 
alpha-D-Kdo-(2->8)-[alpha-D-Kdo-(2->4)]-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcN-4P-(1->6)-alpha-D-GlcN-1P 
alpha-D-Kdo-(2->8)-[alpha-D-Kdo-(2->4)]-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc4P-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc-4P-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc 
alpha-D-Man-(1->2)-alpha-D-Man-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->3)-[alpha-D-Man-(1->2)-alpha-D-Man-(1->6)]-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-mannose +  
alpha-D-mannose 6-phosphate +  
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-D-Manp +  
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-alpha-D-Manp 
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-beta-D-Manp 
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc +  
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-D-Manp-(1->6)-beta-D-Manp +  
alpha-D-Manp6P-(1->3)-alpha-D-Manp-(1->3)-alpha-D-Manp-(1->3)-alpha-D-Manp-(1->2)-D-Manp +  
alpha-D-Rhap-(1->2)-alpha-D-Rhap-(1->3)-alpha-D-Rhap 
alpha-D-Rhap-(1->3)-alpha-D-Rhap 
alpha-D-Rhap-(1->3)-alpha-D-Rhap-(1->2)-alpha-D-Rhap 
alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo 
alpha-D-Rhap4NFo-(1->3)-alpha-D-Rhap4NFo +  
alpha-D-ribose 1-phosphate +  
alpha-KDN-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-D-Glcp 
alpha-KDN-(2->6)-beta-D-Galp-(1->4)-D-GlcpNAc 
alpha-Kdo-(2->8)-[alpha-Kdo-(2->4)]-alpha-Kdo 
alpha-L-Araf-(1->2)-beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp 
alpha-L-Fuc-(1->2)-[alpha-D-Gal-(1->3)]-beta-D-Gal +  
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-D-GlcNAc 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]GlcNAc-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc 
alpha-L-Fuc-(1->3)-[beta-D-Gal-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-L-Fuc-(1->3)-[beta-D-Gal-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-L-Fuc-(1->3)-beta-D-GalNAc-(1->4)-beta-D-GlcNAc-yl group 
alpha-L-fucose +  
alpha-L-fucosyl group +  
alpha-L-fucosyl-(1->2)-beta-D-galactosyl group 
alpha-L-fucosyl-(1->4)-N-acetyl-beta-D-glucosamine +  
alpha-L-Fucp-(1->2)-(1->3)-[alpha-D-Galp]-beta-D-Galp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-alpha-D-GalpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-beta-D-Galp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-beta-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-alpha-D-GalpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-Galp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[beta-D-Galp-(1->3)-alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-D-Glcp 
alpha-L-Fucp-(1->2)-[beta-D-Galp-(1->3)-alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-\{alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-(1->6)\}-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-Glcp6S +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-GlcpNAc6S +  
alpha-L-Fucp-(1->2)-beta-D-Galp6S-(1->4)-D-Glcp +  
alpha-L-Fucp-(1->2)-beta-D-Galp6S-(1->4)-D-Glcp6S +  
alpha-L-Fucp-(1->2)-beta-D-Galp6S-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-[alpha-Neup5Ac-(2->3)-beta-D-Galp6S-(1->4)]-beta-D-GlcpNAc 
alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->4)-[beta-D-Galp3S-(1->3)]-beta-D-GlcpNAc 
alpha-L-FucpNAc-(1->3)-D-FucpNAc 
alpha-L-rhamnopyranose +   
alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->2)-alpha-L-Rhap 
alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->3)-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-L-Rhap 
alpha-L-Rhap-(1->3)-alpha-D-Galp 
alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-L-Rhap-(1->3)-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc 
alpha-maltose 6'-phosphate 
alpha-mycolic acid 
alpha-N-acetylneuraminyl-(2->3)-D-galactosyl group +  
alpha-N-acetylneuraminyl-(2->6)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->6)]-D-GalNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-yl group +  
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-Neu5Ac-(2->6)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-Neu5Ac-(2->3)-D-Gal +  
alpha-Neu9,NAc2-(2->6)-GalNAc 
alpha-Neup5,9Ac2-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5,9Ac2-(2->6)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GalpNAc 
alpha-Neup5Ac-(2->3)-alpha-D-GalpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-D-GalpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-GlcpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-D-Galp-yl group 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[beta-D-Galp-(1->4)-beta-D-Glcp-(1->6)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1->6)]-2,5-anhydro-D-Man 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-D-GalpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp6S-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)]-alpha-D-GalpNAc 
alpha-Neup5Ac-(2->6)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)]-D-GalpNAc +  
alpha-Neup5Ac-(2->6)-beta-D-Galp 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-GalpNAc 
alpha-Neup5Ac-(2->6)-beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac +  
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +   
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-[beta-D-GalpNAc-(1->4)]-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-yl group 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-beta-Neup5Ac 
alpha-Neup5Ac-(2->8)-beta-Neup5Ac 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-D-Glcp-yl group 
alpha-Neup5Gc-(2->6)-alpha-D-GalpNAc 
alpha-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-D-Glcp-yl group 
alpha-NeupNAc-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S 
alpha-ribazole +  
alpha-ribazole 5'-phosphate 
aminoacetone  
aminopropylcadaverine 
ammonium +   
amylose +   
apo-[acyl-carrier protein] 
arbutin 6-phosphate 
Arg-tRNA(Arg) 
argpyrimidine 
arsenic acid  
Asn-tRNA(Asn) 
Asp-tRNA(Asp) 
benzyl cinnamate  
benzylpenamaldate group 
benzylpenamidyl group 
benzylpenicanyl group 
benzylpenicillenyl group 
benzylpenicillin +   
benzylpenicilloic acid 
benzylpenicilloyl group +  
benzylpenilloic acid 
beryllium atom +   
beta-(1->3)-galactobiose +  
beta-cellobiose +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)]-alpha-D-Araf-(1->5)-alpha-D-Araf +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)-alpha-D-Araf-(1->5)-alpha-D-Araf-OMe 
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)]-alpha-D-Araf-(1->5)-alpha-D-Araf-OMe +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)]-alpha-D-Araf-(1->5)-alpha-D-Araf-yl group +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-alpha-D-Araf-(1->5)-alpha-D-Araf 
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-alpha-D-Araf-(1->5)-alpha-D-Araf-OMe 
beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->3)-\{beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-[alpha-L-Fuc-(1->6)]-beta-D-GlcNAc 
beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->3)-\{beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
beta-D-Gal-(1->3)-[beta-D-GlcNAc-(1->6)]-D-GalNAc +  
beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-yl group +  
beta-D-Gal-(1->4)-alpha-D-Glc-(1->3)-[alpha-D-GlcNAc-(1->2)]-alpha-L-Hep 
beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-[beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->4)]-alpha-D-Man-(1->3)-[beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-D-GlcNAc +  
beta-D-galactose +   
beta-D-galactosyl-(1->3)-alpha-D-mannose 
beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl group 
beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl group 
beta-D-galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl group 
beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl group +  
beta-D-Galf-(1->3)-alpha-D-Manp 
beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-GalNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-D-Glc +  
beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-yl group +  
beta-D-GalNAc-(1->4)-beta-D-GalNAc-yl group 
beta-D-Galp-(1->2)-beta-D-Galp +  
beta-D-Galp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->3)-L-glycero-alpha-D-manno-Hepp-(1->5)-Kdo 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-yl group 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcpNAc +  
beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-D-GalpNAc +  
beta-D-Galp-(1->3)-[beta-Neup5Ac-(2->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->3)-\{alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcNAc-(1->6)\}-D-GalNAc +  
beta-D-Galp-(1->3)-beta-D-Galp-(1->3)-beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp 
beta-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp 
beta-D-Galp-(1->3)-beta-D-GalpNAc +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-D-Glcp +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-yl group +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-D-Galp-yl group 
beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp +  
beta-D-Galp-(1->3)-D-GalpNAc +  
beta-D-Galp-(1->3)-D-GlcpNAc +  
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->6)-[beta-D-Galp-(1->3)]-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-D-Glcp +  
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-Glcp6S +  
beta-D-Galp-(1->4)-alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-alpha-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcNAcp-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->4)-beta-D-Glcp6S 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-\{alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc +  
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-[alpha-D-Manp-(1->3)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-D-GalpNAc +  
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)-alpha-D-GalpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp3S-(1->3-)-alpha-D-GalpNAc 
beta-D-Galp3S-(1->3-)-beta-D-GlcpNAc 
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-Glcp +  
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-Glcp6S 
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc6S +  
beta-D-Galp3S-(1->4)-beta-D-Glcp 
beta-D-Galp3S-(1->4)-beta-D-Glcp6S 
beta-D-Galp3S-(1->4)-beta-D-GlcpNAc 
beta-D-Galp3S-(1->4)-beta-D-GlcpNAc6S 
beta-D-Galp4S-(1->4)-beta-D-GlcpNAc 
beta-D-Galp6P-(1->4)-alpha-D-Manp 
beta-D-Galp6S-(1->4)-beta-D-Glcp 
beta-D-Galp6S-(1->4)-beta-D-Glcp6S 
beta-D-Galp6S-(1->4)-beta-D-GlcpNAc 
beta-D-Galp6S-(1->4)-beta-D-GlcpNAc6S 
beta-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp 
beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->3)-alpha-D-GalpNAc 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-D-Galp 
beta-D-GalpNAc-(1->4)-[alpha-Neup5Gc-(2->3)]-beta-D-Galp +  
beta-D-GalpNAc-(1->4)-[alpha-Neup5Gc-(2->3)]-beta-D-Galp-(1->4)-R group +  
beta-D-GalpNAc-(1->4)-alpha-D-GalpNAc 
beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
beta-D-GalpNAc-(1->4)-D-GlcpNAc +  
beta-D-GlcNAc-(1->4)-MDP-Lys(L18) 
beta-D-Glcp(1->6)-alpha-D-GlcpNAc-(1->3)-alpha-L-QuipNAc-(1->3)-beta-D-GlcpNAc 
beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-GlcpO[CH2]5CO2Me 
beta-D-Glcp-(1->6)-beta-D-Glcp +  
beta-D-GlcpA-(1->3)-beta-D-Galp +  
beta-D-GlcpA-(1->3)-beta-D-GlcpNAc 
beta-D-GlcpA-(1->6)-beta-D-Galp 
beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->4)]-[beta-D-GlcpNAc-(1->6)]-D-GlcpNAc 
beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->3)-alpha-D-GalpNAc +  
beta-D-GlcpNAc-(1->3)-beta-D-Galp +  
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->3)-D-Manp +  
beta-D-GlcpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-GlcpNAc-(1->4)-[beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc +  
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->6)-alpha-D-GalpNAc +  
beta-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc6S-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-glucose +   
beta-D-glucose 6-phosphate 
beta-D-glucosyl-N-(octadecanoyl)sphinganine 
beta-D-mannose +  
beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-alpha-D-Manp +  
beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-beta-D-Manp +  
beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-D-Manp +  
beta-D-QuiN4Fm-(1->4)-alpha-D-GalNAcAN-(1->4)-alpha-D-GalNAcAN-(1->3)-beta-D-QuiNAc-yl group 
beta-D-QuiN4Fm-(1->4)-alpha-D-GalNAcAN-yl group 
beta-D-Tyvp-(1->3)-beta-D-GalpN-OMe 
beta-D-Tyvp-(1->3)-beta-D-GalpN6,OMe2 
beta-D-Tyvp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-OMe 
beta-D-Tyvp-(1->3)-beta-D-GalpNAc-OMe 
beta-D-Tyvp-(1->3)-beta-D-GalpNAc6,OMe2 
beta-D-Tyvp2Me-(1->3)-beta-D-GalpN6,OMe2 
beta-D-Tyvp2Me-(1->3)-beta-D-GalpNAc-OMe 
beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->4)-R group +  
beta-L-Ara4N-lipid A (E. coli) 
beta-L-fucosyl-(1->3)-N-acetyl-beta-D-glucosamine 
beta-melibiose 
beta-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-D-GlcpNAc 
beta-NeupNAc-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
betaine aldehyde 
biotin +   
bromohydrin pyrophosphate 
butanal +   
butane-2,3-dione  
butyryl-CoA +   
cadaverine +   
canthaxanthin  
carbamic acid +   
carbamoyl phosphate 
carbon dioxide  
carboxyacetyl-[acyl-carrier protein] 
cardiolipin +  
CDP +   
CDP-diacylglycerol +  
chloramphenicol +   
chloride +   
choline +   
choline alfoscerate 
chorismic acid +  
ciguatoxin ABC ring fragment 
ciguatoxin ABCDE ring fragment 
ciguatoxin JKLM ring fragment 
CII259-273 
cob(I)alamin 
cobamamide +   
cobinamide +  
coenzyme A +   
copper atom +   
coproporphyrinogen III  
CTP +   
Cys-tRNA(Cys) 
cytidine +   
cytidine 5'-monophosphate +   
cytosine +   
D-alanine +  
D-alanyl-D-alanine 
D-alanyl-D-alanine zwitterion 
D-allose 6-phosphate 
D-alpha-D-Hepp-(1->6)-beta-D-Glcp 
D-altronic acid 
D-arabinose 5-phosphate +  
D-erythro-1-(imidazol-4-yl)glycerol 3-phosphate 
D-erythrose 4-phosphate  
D-galactopyranose +   
D-galactosamine 6-phosphate 
D-galactosamine 6-phosphate(1-) 
D-glucitol +   
D-glucitol 6-phosphate 
D-glucopyranose +   
D-glucopyranuronate +  
D-glutamic acid +  
D-glyceraldehyde +   
D-glycero-D-manno-heptose 1,7-bisphosphate +  
D-glycero-D-manno-heptose 1-phosphate 
D-glycero-D-manno-heptose 7-phosphate +  
D-mannitol +   
D-mannitol 1-phosphate 
D-mannonate 
D-methioninate 
D-methioninium 
D-ribulose +  
D-ribulose 1,5-bisphosphate 
D-serine +  
D-tagatose 1,6-bisphosphate +  
D-tagaturonate 
D-tartaric acid +  
D-tyrosinate(1-) 
D-tyrosinate(2-) 
D-tyrosine +  
D-tyrosinium 
D-xylulose +   
D-xylulose 5-phosphate  
dADP +  
dATP 
dCDP 
dCTP +   
deamido-NAD(+) +   
decanoyl-[acyl-carrier protein] 
decanoyl-CoA +   
decarboxysuprofen 
decarboxytiaprofenic acid 
dehydroglycine 
Delta(9)-tetrahydrocannabinol +   
dethiobiotin +  
dGTP  
Dig-Cy5 
digoxin +   
dihydrofolic acid  
dihydroxyacetone +   
dihydroxyacetone phosphate  
dimethyl sulfide +  
dimethyl sulfoxide +   
diphosphoric acid +   
dITP 
ditrans,polycis-undecaprenyl diphosphate 
Dnp-Asn-Gln 
Dnp-Gln 
Dnp-Nor-Gln 
Dnp-Sar-Gln 
Dnp-Thr-Gln 
Dnp-Trp-Gln 
dopamine +   
doxorubicin +   
dT4 
dT6 
dT8 
dTDP +   
dTDP-4-dehydro-6-deoxy-alpha-D-glucose 
dTDP-alpha-D-glucose +  
dTDP-beta-L-rhamnose 
dTT(6-4)TT 
dTTP +  
dUDP 
dUMP +   
dUTP +  
E. coli strain 0111 B4 lipopolysaccharide 
ecgonine benzoate  
ENPAVHFFKNIVTPRTP 
ENPVVAFFKNIVTPRTP 
ENPVVHFFFNIVTPRTP 
ENPVVHFFKNIVTPRTP 
ENPVVHFFYNIVTPRTP 
estriol 3-O-(beta-D-glucuronide)  
ethanol +   
ethanolamine +   
ethyl dihydrogen phosphate +   
ethyl hydrogen phosphate(1-) 
ethyl phosphate(2-) 
FAD  
FADH2 +  
ferrichrome  
ferrienterobactin(3-) 
ferrioxamine B 
flucofuron 
fluorescein-DNP hapten 
fMet-tRNA(fMet) 
FMNH2 +  
formaldehyde +   
formyl-CoA 
framycetin +   
fructoselysine 6-phosphate 
fructosyllysine 
fusidic acid  
galactitol +  
galactitol 1-phosphate 
gamma-glutamyl-gamma-aminobutyraldehyde 
gamma-L-glutamylputrescine 
GDP +   
GDP-4-dehydro-6-deoxy-alpha-D-mannose 
GDP-alpha-D-mannose +  
GDP-mannose +  
geranyl diphosphate  
Gln-tRNA(Gln) 
Glu-tRNA(Glu) 
glucuronic acid +   
glutathione +   
glutathione disulfide  
glutathionylspermidine 
glutathioselenol +  
Gly-tRNA(Gly) 
glyceraldehyde 3-phosphate +   
glycerol +   
glycerol 2-phosphate  
glycogen  
glyoxal-lysine dimer 
glyoxylic acid +   
GTP +   
guanine +   
guanosine 3',5'-bis(diphosphate) 
guanosine 3'-diphosphate 5'-triphosphate 
guanosine 3'-monophosphate 
guanosine 5'-monophosphate +   
heme o +  
hexanoyl-CoA +   
His-tRNA(His) 
holo-[acyl-carrier protein] 
homocysteine zwitterion 
homoserine lactone +   
HS44 
hydrogen cyanide +   
hydrogen peroxide +   
hydrogen sulfide +   
hydrogencarbonate +   
hydroquinone +   
hydroquinone O-beta-D-glucopyranoside +   
hydroxyacetone +  
Ile-tRNA(Ile) 
iminoaspartic acid 
IMP +   
inosine +   
iron atom +   
iron(3+) +   
iron(III) dicitrate(3-) 
iron(III) hydroxamate +   
isopentenyl diphosphate  
isopentenyl diphosphate(3-) 
isopropyl dihydrogen phosphate 
ITP +  
keto mycolic acid 
L-2-aminoadipic acid +  
L-3-oxoalanine +  
L-allothreonine 
L-arabinopyranose +  
L-arginine +   
L-asparagine +   
L-aspartic acid +   
L-citrulline +  
L-citrulline zwitterion +  
L-cystathionine  
L-cysteate(1-) +  
L-cysteic acid 
L-cysteinylglycine +  
L-cysteinylglycine zwitterion 
L-fucopyranose +  
L-fuculose +  
L-galactonic acid +  
L-gamma-glutamyl phosphate +  
L-gamma-glutamyl-L-cysteine +   
L-glutamic 5-semialdehyde +  
L-glutamic acid +   
L-glutamine +   
L-glycero-alpha-D-manno-Hepp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->3)-L-glycero-alpha-D-manno-Hepp-(1->5)-alpha-Kdo 
L-histidinate(1-) 
L-histidinate(2-) 
L-histidine +   
L-histidinium(1+) +  
L-histidinium(2+) 
L-histidinol +  
L-histidinol phosphate 
L-homoserine +  
L-idonate +  
L-idonic acid +  
L-idopyranose 6-monomycolate 
L-isoleucinate 
L-isoleucine +   
L-isoleucinium +  
L-leucinate +  
L-leucine +   
L-leucinium +  
L-lysinate 
L-lysine +   
L-lysinium(1+) +  
L-lysinium(2+) +  
L-methioninate +   
L-methionine (R)-S-oxide +  
L-methionine S-oxide +  
L-methioninium +  
L-phenylalaninate +  
L-phenylalanine +   
L-phenylalaninium +  
L-proline +   
L-rhamnulose +  
L-rhamnulose 1-phosphate 
L-ribulose +  
L-ribulose 5-phosphate 
L-serine +   
L-Thr-(N->6)-alpha-D-Galp6d3OAc-(1->3)-beta-D-GalpNAc 
L-threoninate 
L-threonine +  
L-threoninium +  
L-tryptophan +   
L-valine +   
L-xylulose +  
L-xylulose 5-phosphate 
lactate +  
lauroyl-CoA +   
Leu-tRNA(Leu) 
lipid A (E. coli) +  
lipid X 
lipoamide +   
lipoprotein +  
lipoyl-AMP +  
LL-2,6-diaminopimelic acid +  
Lys-GalA 
Lys-Thr-Trp-Gly-Lys-Asn-Leu-Val-Phe 
Lys-tRNA(Lys) 
maleamic acid 
malonyl-CoA  
maltohexaose 
maltose +   
maltotetraose 
manganese atom +   
mannitol +   
mannonic acid +  
marinobufagenin  
melibiose +   
menaquinol +  
menaquinone +   
menaquinone-9 +  
mercury(2+) 
meso-2,6-diaminopimelic acid dizwitterion 
Met-tRNA(Met) 
methacholine +   
methanesulfonic acid +   
methanol +   
methionine +   
methoxy mycolic acid 
methyl 4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-2-O-methyl-alpha-D-mannopyranoside 
methyl dihydrogen phosphate  
methyl nonanoate 
methyl phosphate(2-) 
methylglyoxal +   
methylglyoxal-lysine dimer 
minocycline +   
Mo-molybdopterin cofactor +  
molybdate +   
myo-inositol +   
myo-inositol hexakisphosphate  
myristoyl-[acyl-carrier protein] 
myristoyl-CoA +   
N(1)-(5-phospho-D-ribosyl)glycinamide 
N(1)-acetylspermidine 
N(2)-(5'-phosphopyridoxyl)-L-lysine 
N(2)-acetyl-L-ornithine 
N(2)-acetyl-L-ornithine zwitterion 
N(2)-succinyl-L-arginine 
N(2)-succinyl-L-glutamic acid 
N(2)-succinyl-L-ornithine 
N(6)-acetyl-N(2)-(5'-phosphonatopyridoxyl)-L-lysinate(2-) 
N(6)-acetyl-N(2)-(5'-phosphopyridoxyl)-L-lysine 
N(6)-dansyl-L-lysine 
N(6)-Dnp-Lys-NH2 
N(8)-acetylspermidine 
N(alpha)-methyl-L-tryptophan 
N,N'-diacetylchitobiose +  
N,N-dimethyltetradecanamide 
N,O-(Dnp)2-Tyr-Gln 
N-(2,3-dihydroxybenzoyl)-L-serine 
N-(5'-phosphonatopyridoxyl)-D-alaninate(2-) 
N-(5'-phosphonatopyridoxyl)-L-alaninate(2-) 
N-(5'-phosphopyridoxyl)-D-alanine 
N-(5'-phosphopyridoxyl)-L-alanine 
N-(p-nitrophenylphosphobutanoyl)glycine 
N-(trans-4'-nitro-4-stilbenyl)-N-methyl-5-aminopentanoic acid 
N-[(9-beta-D-ribofuranosylpurin-6-yl)carbamoyl]threonate 
N-[(9-beta-D-ribofuranosylpurin-6-yl)carbamoyl]threonine 
N-[(R)-4-phosphopantothenoyl]-L-cysteine 
N-[4-(4-nitrophenylphospho)butanoyl]-D-alanine 
N-[4-(4-nitrophenylphospho)butanoyl]-L-alanine 
N-\{beta-D-Man-(1->2)-beta-D-Man-(1->2)-beta-D-ManO[CH2]3S[CH2]2NHC(O)[CH2O]4C(O)[CH2]2S[CH2]2C(O)\}-YGKDVKDLFDYAQE-NH-[CH2O]3[CH2]2C(O)NHC(CO2H)[CH2]4N3 +  
N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 
N-acetyl-alpha-D-galactosamine +  
N-acetyl-alpha-D-galactosamine 1-phosphate 
N-acetyl-alpha-D-galactosaminyl group +  
N-acetyl-alpha-D-galactosaminyl-(1->3)-[alpha-L-fucosyl-(1->2)]-beta-D-galactose derivative 
N-acetyl-alpha-D-galactosaminyl-L-serine residue 
N-acetyl-alpha-neuraminic acid +  
N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucose +  
N-acetyl-alpha-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosamine 
N-acetyl-beta-D-galactosamine +  
N-acetyl-beta-D-galactosaminyl-(1->4)-N-acetyl-beta-D-glucosaminyl group 
N-acetyl-beta-D-glucosamine +   
N-acetyl-beta-D-glucosaminyl-(1->4)-N-acetyl-beta-D-glucosamine +  
N-acetyl-beta-neuraminic acid +   
N-acetyl-beta-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosamine 
N-acetyl-D-galactosamine +  
N-acetyl-D-glucosamine 6-phosphate +  
N-acetyl-D-glucosaminyl-1-diphospho-ditrans,polycis-undecaprenol +  
N-acetyl-L-gamma-glutamyl phosphate 
N-acetylmuramic acid 6-phosphate +  
N-acetylneuraminyl group 
N-carbamoylaspartic acid +  
N-glycoloyl-beta-D-glucosamine 
N-methylmesoporphyrin 
N-octanoylisoglobotriaosyl ceramide 
N-succinyl-L-glutamic 5-semialdehyde 
N-succinyl-LL-2,6-diaminopimelic acid 
NAD(+)  
nickel atom +   
nicotinamide +   
nicotinic acid +   
nicotinic acid D-ribonucleotide +  
nitric oxide  
NMN zwitterion  
novobiocin  
O(4)-phospho-L-tyrosine +  
O-(2-aminopropyl)-O'-(2-methyoxyethyl)octa(propylene glycol) 
O-[N-acetyl-alpha-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosaminyl]-L-serine residue 
O-hydroxy(phenyl)phosphinoyl ecgonine methyl ester 
O-phospho-L-homoserine 
O-phospho-L-serine +  
O-phospho-L-threonine +  
O-phosphonato-L-serine(2-) +  
O-succinyl-L-homoserinate(1-) 
O-succinyl-L-homoserine 
octanoic acid +   
octanoyl-[acyl-carrier protein] 
octanoyl-CoA +  
oleate +  
oleic acid +   
oleoyl-CoA  
oregon green 488 
ornidazole  
ornithine +   
orotic acid +   
orotidine 5'-phosphate 
oxaluric acid 
oxalyl-CoA 
oxamic acid +   
P(1),P(4)-bis(5'-adenosyl) tetraphosphate  
P(1),P(4)-bis(5'-guanosyl) tetraphosphate  
P(1),P(5)-bis(5'-adenosyl) pentaphosphate  
p-cresol +   
p-nitrobenzyl glutaryl glycinic acid 
p-nitrophenylphosphocholine 
P. aeruginosa serotype O11 O-specific polysaccharide 
palmitoleic acid +   
palmitoleyl alcohol +  
palmitoyl-[acyl-carrier protein] 
palmitoyl-CoA +   
palmityl acetate 
Phe(4-NO2)-Gln 
Phe-tRNA(Phe) 
phenolic phthiocerol +  
phenylacetaldehyde +   
phenylacetate +  
phenylacetic acid +   
phenylacetyl-CoA +  
phosphatidic acid +   
phosphatidylglycerol +   
phosphocholine +   
phthalaldehyde  
phthiocerol A +  
pimelate(1-) 
pimelic acid +  
polyprenol phosphate +   
porphobilinogen  
precorrin-2 +  
precursor Z hydrate 
prenyl diphosphate  
prenyl diphosphate(3-) 
prenyl phosphate 
prenyl-FMNH2 
prephenate(2-) +  
prephenic acid +  
preuroporphyrinogen  
Pro-tRNA(Pro) 
propanal +   
propanoyl phosphate 
propionyl-CoA +   
protoporphyrin +   
protoporphyrinogen  
pyridoxal +   
pyridoxal 5'-phosphate +   
pyridoxal hydrochloride 
pyridoxamine +   
pyridoxamine 5'-phosphate 
pyridoxamine dihydrochloride 
pyridoxamine hydrochloride 
pyridoxaminium(1+) +  
pyridoxine +   
pyridoxine 5'-phosphate 
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 
queuine +  
quinolinic acid  
Reactive Red 6 hapten copper complex 
riboflavin +   
ribothymidine +  
rifampicin +   
S-(5-deoxy-beta-D-ribos-5-yl)-L-homocysteine 
S-(hydroxymethyl)glutathione  
S-adenosyl-4-methylthio-2-oxobutanoic acid 
S-adenosyl-L-homocysteine  
S-adenosyl-S-carboxymethyl-L-homocysteine 
S-adenosylmethioninamine 
S-formylglutathione 
S-methyl-L-methionine 
SAICAR  
sarcosine +  
secnidazole 
sedoheptulose 1,7-bisphosphate  
sedoheptulose 7-phosphate 
selane +  
selenodiglutathione 
Ser-tRNA(Ser) 
shikimate +  
shikimic acid +   
silver(0)  
siroheme 
sirohydrochlorin +  
sn-glycerol 3-phosphate 
sodium amoxicilloyl group 
sodium glyoxylate 
stearoyl-CoA  
succinic semialdehyde +   
succinyl-CoA  
sucrose +   
sucrose 6(F)-phosphate 
sucrose 6(G)-phosphate 
sulcofuron 
sulcofuron-sodium 
sulfamethoxazole +   
sulfoacetic acid +  
sulfur dioxide  
superoxide  
SW-163E 
taurine +   
tetracycline +   
tetradecaethylene glycol 
thiamine(1+) +   
thiamine(1+) monophosphate +  
thiocyanic acid +  
thioredoxin disulfide 
Thr-tRNA(Thr) 
thymidine +   
thymine +   
Tnp-Gln 
trans-2-octadecenoyl-CoA 
trans-4-(dimethylphenylsilyl)-N-methylpiperidine N-oxide 
trans-dec-2-enoyl-CoA 
trans-dodec-2-enoyl-CoA 
trans-hex-2-enoyl-CoA 
trans-oct-2-enoyl-CoA 
trans-tetradec-2-enoyl-CoA 
trimellitic anhydride  
trimethylamine +   
trimethylamine N-oxide  
tRNA(Ala) +  
tRNA(Arg) +  
tRNA(Asn) +  
tRNA(Asp) +  
tRNA(Cys) +  
tRNA(Gln) +  
tRNA(Glu) +  
tRNA(Gly) +  
tRNA(His) +  
tRNA(Ile) +  
tRNA(Leu) +  
tRNA(Lys) +  
tRNA(Met) +  
tRNA(Phe) +  
tRNA(Pro) +  
tRNA(Ser) +  
tRNA(Thr) +  
tRNA(Trp) +  
tRNA(Tyr) +  
tRNA(Val) +  
Trp-Gly-Ile-His-His 
Trp-tRNA(Trp) 
Trp-Tyr-Gly-Tyr-His-His 
Tyr-tRNA(Tyr) 
tyramine +   
ubiquinol +  
ubiquinone-0 
ubiquinones +   
UDP +   
UDP-2,3-bis(3-hydroxytetradecanoyl)-D-glucosamine 
UDP-4-amino-4-deoxy-beta-L-arabinopyranose +  
UDP-4-deoxy-4-formamido-beta-L-arabinopyranose 
UDP-alpha-D-glucuronic acid +   
UDP-beta-L-threo-pentopyranos-4-ulose 
UDP-N-acetyl-alpha-D-glucosamine  
UDP-N-acetylmuramoyl-L-alanyl-gamma-D-glutamyl-meso-2,6-diaminopimeloyl-D-alanyl-D-alanine 
undecaprenyldiphospho-N-acetyl-(N-acetylglucosaminyl)muramoyl-L-alanyl-D-gamma-glutamyl-meso-2,6-diaminopimeloyl-D-alanyl-D-alanine 
uracil +   
urea +   
uridine 5'-monophosphate +  
uroporphyrinogen III 
UTP +   
Val-tRNA(Val) 
water +   
xanthosine 
XDP 
XTP +  

Synonyms
Exact Synonyms: (2E)-4-hydroxy-3-methylbut-2-en-1-yl trihydrogen diphosphate
Related Synonyms: (2E)-4-hydroxy-3-methylbut-2-en-1-yl pyrophosphate ;   (E)-4-Hydroxy-3-methyl-but-2-enyl diphosphate ;   (E)-4-Hydroxy-3-methylbut-2-en-1-yl diphosphate ;   (E)-4-Hydroxy-3-methylbut-2-enyl diphosphate ;   (E)-4-hydroxy-3-methyl-2-buten-1-yl diphosphate ;   (E)-4-hydroxy-3-methyl-2-buten-1-yl pyrophosphate ;   (E)-4-hydroxy-3-methylbut-2-enyl pyrophosphate ;   1-Hydroxy-2-methyl-2-butenyl 4-diphosphate ;   1-hydroxy-2-methylbut-2(E)-en-4-yl diphosphate ;   1-hydroxy-2-methylbut-2(E)-en-4-yl pyrophosphate ;   Formula=C5H12O8P2 ;   HMBPP ;   InChI=1S/C5H12O8P2/c1-5(4-6)2-3-12-15(10,11)13-14(7,8)9/h2,6H,3-4H2,1H3,(H,10,11)(H2,7,8,9)/b5-2+ ;   InChIKey=MDSIZRKJVDMQOQ-GORDUTHDSA-N ;   SMILES=C\\C(CO)=C/COP(O)(=O)OP(O)(O)=O
Alternate IDs: CHEBI:10952 ;   CHEBI:632
Xrefs: Beilstein:9060574 ;   KEGG:C11811 ;   KNApSAcK:C00007567 ;   PDBeChem:H6P ;   PMID:12203549 ;   PMID:12646635 ;   PMID:19919056 ;   PMID:23872678 ;   Reaxys:9060574
Cyclic Relationships: is_conjugate_acid_of CHEBI:128753

paths to the root

NHLBI Logo

RGD is funded by grant HL64541 from the National Heart, Lung, and Blood Institute on behalf of the NIH.