Submit Data |  Help |  Video Tutorials |  News |  Publications |  FTP Download |  REST API |  Citing RGD |  Contact   

Ontology Browser

Term:
Parent Terms Term With Siblings Child Terms
(-)-ureidoglycolic acid 
(1->4)-beta-D-mannan 
(1-naphthyl)methanol 
(12S)-hydroperoxy-(14R,15S)-epoxy-(5Z,8Z,10E)-icosatrienoic acid 
(12S)-hydroperoxy-(14S,15R)-epoxy-(5Z,8Z,10E)-icosatrienoic acid 
(1R,2S)-naphthalene 1,2-oxide 
(1R,2S,5S,6S)-2-(3-carboxypropanoyl)-5-[(1-carboxyvinyl)oxy]-6-hydroxycyclohex-3-ene-1-carboxylic acid 
(2-aminoethyl)phosphonic acid +  
(2-hydroxyphenyl)acetic acid 
(2-naphthyl)methanol +  
(2-trans,6-cis)-dodeca-2,6-dienoyl-CoA 
(20R)-17alpha,20-dihydroxycholesterol 
(20R,22R)-20,22-dihydroxycholesterol 
(20S)-17,20-dihydroxypregn-4-en-3-one 
(20S)-20-hydroxypregn-4-en-3-one  
(24Z),26-hydroxydesmosterol 
(25R)-cholest-5-ene-3beta,26-diol +   
(2E)-3-(methoxycarbonyl)pent-2-enedioic acid 
(2E)-4-hydroxy-3-methylbut-2-en-1-yl diphosphate 
(2E)-4-hydroxy-3-methylbut-2-enyl diphosphate(3-) 
(2E,4E)-3,8,8,8-tetrachloro-7-(4-chlorophenyl)-2-hydroxy-6-oxo-octa-2,4-dienoate 
(2E,5Z,7E)-decatrienoylcarnitine 
(2S)-2-hydroxy-2-methyl-3-oxobutanoic acid 
(2S,3R)-3-hydroxybutane-1,2,3-tricarboxylic acid 
(2S,3S)-3-hydroxy-2-methylbutanoyl-CoA 
(2S,6S)-2,6-diaminopimelic acid dizwitterion 
(3R)-3-isopropenyl-6-oxoheptanoyl-CoA 
(3S)-3-hydroxy-3-methylglutaryl-CoA 
(3S)-3-isopropenyl-6-oxoheptanoyl-CoA 
(3S,4R)-3,4-dihydrophenanthrene-3,4-diol 
(3Z,6Z)-dodecadienoyl-CoA 
(4-hydroxy-3-methoxyphenyl)acetaldehyde 
(4-hydroxyphenyl)acetaldehyde 
(4E,7E,10E,13E,16E)-docosapentaenoylcarnitine 
(4E,7E,10E,13E,16E,19E)-docosahexaenoylcarnitine 
(4S)-2-methylpentane-2,4-diol 
(4Z)-2,8:7,12:11,15:14,18:17,22-pentaanhydro-4,5,6,9,10,13,19,20,21-nonadeoxy-L-arabino-L-allo-L-allo-docosa-4,9,20-trienitol 
(4Z,7Z,10Z,12E,14S,16Z,19Z,21R)-dihydroxydocosahexaenoic acid 
(4Z,7Z,10Z,13Z,15E,17S,19Z)-17-hydroperoxydocosahexaenoic acid 
(4Z,7Z,10Z,13Z,16Z)-docosapentaenoyl-CoA 
(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoyl-CoA 
(4Z,7Z,10Z,14E,16Z,19Z)-13-hydroxydocosahexaenoate 
(4Z,7Z,10Z,14E,16Z,19Z)-13-hydroxydocosahexaenoic acid 
(5-hydroxyindol-3-yl)acetaldehyde  
(5-hydroxyindol-3-yl)acetic acid  
(5-oxo-2-sulfo-2,5-dihydrofuran-2-yl)acetic acid 
(5S)-hydroperoxy-(14R,15S)-epoxy-(6E,8Z,11Z)-icosatrienoic acid 
(5Z,11Z,14Z)-8,9-dihydroxyicosatrienoic acid +  
(5Z,8Z,10E,14Z)-12-hydroxyicosatetraenoic acid +  
(5Z,8Z,11Z)-14,15-dihydroxyicosatrienoic acid +  
(5Z,8Z,11Z,13E)-15-HETE +   
(5Z,8Z,14Z)-11,12-dihydroxyicosatrienoic acid +  
(6R)-5,10-methenyltetrahydrofolic acid 
(6R)-5,10-methylenetetrahydrofolic acid +  
(6Z,9Z,12Z,15Z)-octadecatetraenoyl-CoA 
(6Z,9Z,12Z,15Z,18Z)-tetracosapentaenoyl-CoA 
(6Z,9Z,12Z,15Z,18Z,21Z)-3-hydroxytetracosahexaenoyl-CoA 
(6Z,9Z,12Z,15Z,18Z,21Z)-3-oxotetracosahexaenoyl-CoA 
(6Z,9Z,12Z,15Z,18Z,21Z)-tetracosahexaenoyl-CoA 
(7Z,10Z,13R,14E,16Z,19Z)-13-hydroxydocosapentaenoate 
(7Z,10Z,13R,14E,16Z,19Z)-13-hydroxydocosapentaenoic acid 
(8R,9S)-EET 
(8S)-hydroperoxy-(14S,15R)-epoxy-(5Z,9E,11Z)-icosatrienoic acid 
(E)-4-oxonon-2-en-1-ol 
(E)-hexadec-2-enoyl-CoA 
(KDO)-lipid IVA 
(KDO)2-(lauroyl)-lipid IVA 
(Kdo)2-lipid A (E. coli) +  
(KDO)2-lipid IVA 
(N(omega)-L-arginino)succinic acid  
(R)-(-)-allantoin 
(R)-1,2-distearoylphosphatidylethanolamine 
(R)-3-hydroxy-2-oxo-4-phosphonooxybutanoic acid 
(R)-3-hydroxybutanoyl-CoA 
(R)-4'-phosphopantothenic acid 
(R)-5-diphosphomevalonic acid 
(R)-5-phosphomevalonic acid 
(R)-adrenaline +   
(R)-lactaldehyde 
(R)-lactic acid +   
(R)-methylmalonyl-CoA 
(R)-noradrenaline  
(R)-propane-1,2-diol 
(R)-S-lactoylglutathione 
(S)-(+)-allantoin +  
(S)-1-phenylethanol 
(S)-2,3-epoxysqualene 
(S)-2-(4-nitrobenzyl)-DOTA 
(S)-2-\{4-[2-(2-hydroxyethylthio)acetamido]benzyl\}-DOTA 
(S)-2-methylbutanoyl-CoA 
(S)-3'-hydroxy-N-methylcoclaurine 
(S)-3-hydroxybutanoyl-CoA 
(S)-3-hydroxyhexanoyl-CoA 
(S)-3-hydroxyisobutyryl-CoA 
(S)-3-hydroxylauroyl-CoA 
(S)-3-hydroxyoctanoyl-CoA 
(S)-3-hydroxypalmitoyl-CoA 
(S)-3-hydroxytetradecanoyl-CoA 
(S)-4,5-dihydroxypentane-2,3-dione 
(S)-4-amino-5-oxopentanoic acid 
(S)-carnitinium 
(S)-dihydroorotic acid 
(S)-lactaldehyde 
(S)-lactic acid +   
(S)-methylmalonaldehydic acid 
(S)-methylmalonyl-CoA 
(S)-N-methylcoclaurine 
(S)-propane-1,2-diol +  
(Z)-but-2-ene-1,2,3-tricarboxylic acid 
(Z)-hexadec-11-enal 
(Z)-icos-13-enoic acid 
->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)]-beta-D-Galp-yl group 
->4)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
->8)-alpha-Neu5Ac-(2->3)-[beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)]-beta-D-Gal-(1->4)-yl group +   
1,1-dichloro-2-(4-chloro-2,3-dihydroxyphenyl)-2-(4-chlorophenyl)ethylene 
1,1-dichloroethene  
1,2,3-trilinoleoylglycerol  
1,2,4-butanetriol 
1,2-bis(4-hydroxyphenyl)propan-2-ol 
1,2-bis(octadec-9-enoyl)phosphatidic acid +   
1,2-bis-[(9Z,11Z)-octadecadienoyl]-sn-glycero-3-phosphoethanolamine 
1,2-di-(4Z,7Z,10Z,13Z,16Z,19Z-docosahexaenoyl)-sn-glycero-3-phosphoethanolamine 
1,2-di-(6Z,9Z-octadecadienoyl)-sn-glycero-3-phosphoethanolamine 
1,2-di-(7Z,10Z,13Z,16Z-docosatetraenoyl)-sn-glycerol 
1,2-di-(9E-hexadecenoyl)-sn-glycero-3-phosphocholine 
1,2-di-(9E-octadecenoyl)-sn-glycero-3-phospho-(1'-sn-glycerol) 
1,2-di-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphoethanolamine 
1,2-di-[(6Z)-octadecenoyl]-sn-glycero-3-phosphoethanolamine 
1,2-di-[(9E)-octadecenoyl]-sn-glycero-3-phosphoethanolamine 
1,2-di-[(9Z)-octadecenoyl]-sn-glycero-3-phosphoethanolamine 
1,2-di-O-[1-(14)C]-palmitoyl-sn-glycero-3-phosphocholine 
1,2-di-O-myristoyl-sn-glycero-3-phosphocholine 
1,2-di-O-palmitoyl-sn-glycero-3-phosphocholine 
1,2-di-octadecadienoyl-sn-glycero-3-phosphocholine +  
1,2-di-octadecenoyl-sn-glycero-3-phosphocholine +  
1,2-di-palmitoleoyl-2-sn-glycerol 
1,2-diacyl-3-beta-D-galactosyl-sn-glycerol +  
1,2-dibromoethane  
1,2-dihexadecanoyl-sn-glycero-3-phosphocholine  
1,2-dihexadecanoyl-sn-glycero-3-phosphoethanolamine 
1,2-dihexadecanoyl-sn-glycero-3-phosphoserine 
1,2-dihydronaphthalene-1,2-diol +   
1,2-dihydroxy-3,4-epoxy-1,2,3,4-tetrahydronaphthalene 
1,2-dihydroxyfluorene 
1,2-dilinoleoyl-sn-glycerol 
1,2-dimyristoleoyl-sn-glycerol 
1,2-dioctadecadienoyl-sn-glycero-3-phospho-(1'-sn-glycerol) 
1,2-dioleoyl-3-linoleoyl-sn-glycerol 
1,2-dioleoyl-sn-glycero-3-phospho-L-serine 
1,2-dioleoyl-sn-glycerol 
1,2-dipalmitoleoyl-sn-glycero-3-phosphocholine 
1,2-dipalmitoyl-sn-glycerol 
1,2-distearoyl-sn-glycero-3-phosphoserine 
1,2-ditetradecanoyl-3-(6-sulfoquinovopyranosyl)glycerol 
1,2-palmitoyl-sn-glycero-3-phospho-(1'-sn-glycerol) 
1,3,7-trimethyluric acid  
1,4-benzoquinone +   
1,4-dihydroxy-2-naphthoate 
1,4-dihydroxy-2-naphthoic acid +   
1,4-dihydroxy-2-naphthoyl-CoA 
1,6:5,9:8,12:11,16-tetraanhydro-2,3,4,10,13,14-hexadeoxy-D-glycero-D-allo-D-gulo-heptadeca-2,13-dienitol 
1,7,8,9,10,10-hexachloro-4-methyl-4-azatricyclo[5.2.1.0(2,6)]dec-8-ene-3,5-dione 
1,7-dimethyluric acid  
1,7-dimethylxanthine  
1-(1Z,11Z-octadecadienyl)-2-linoleoyl-sn-glycero-3-phosphoethanolamine 
1-(1Z,9Z-octadecadienyl)-2-(4Z,7Z,10Z,13Z,16Z,19Z-docosahexaenoyl)-sn-glycero-3-phosphoethanolamine 
1-(1Z-hexadecenyl)-2-(4Z,7Z,10Z,13Z,16Z,19Z-docosahexaenoyl)-sn-glycero-3-phosphoethanolamine 
1-(1Z-hexadecenyl)-2-(8Z,11Z,14Z-icosatrienoyl)-sn-glycero-3-phosphoethanolamine 
1-(1Z-hexadecenyl)-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphocholine 
1-(1Z-hexadecenyl)-2-(9Z-hexadecenoyl)-sn-glycero-3-phosphocholine 
1-(1Z-hexadecenyl)-2-arachidonoyl-sn-glycero-3-phosphoethanolamine 
1-(1Z-hexadecenyl)-2-linoleoyl-sn-glycero-3-phosphoethanolamine 
1-(1Z-hexadecenyl)-2-oleoyl-sn-glycero-3-phosphoethanolamine 
1-(1Z-octadecenyl)-2-(4Z,7Z,10Z,13Z,16Z-docosapentaenoyl)-sn-glycero-3-phosphoethanolamine 
1-(1Z-octadecenyl)-2-(8Z,11Z,14Z-icosatrienoyl)-sn-glycero-3-phosphoethanolamine 
1-(1Z-octadecenyl)-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphocholine 
1-(1Z-octadecenyl)-2-(9Z-octadecenoyl)-sn-glycero-3-phosphoethanolamine 
1-(1Z-octadecenyl)-2-arachidonoyl-sn-glycero-3-phosphoethanolamine 
1-(1Z-octadecenyl)-2-hexadecanoyl-sn-glycero-3-phosphocholine 
1-(1Z-octadecenyl)-2-hexadecanoyl-sn-glycero-3-phosphoethanolamine 
1-(1Z-octadecenyl)-2-linoleoyl-sn-glycero-3-phosphoethanolamine 
1-(1Z-octadecenyl)-2-linoleoyl-sn-glycero-3-phosphoethanolamine zwitterion 
1-(2,3-dihydro-1H-pyrrolizin-5-yl)-2-propen-1-one 
1-(2-carboxyphenylamino)-1-deoxy-D-ribulose 5-phosphate 
1-(3,6-di-O-sulfo-beta-D-galactosyl)-N-lauroylsphingosine 
1-(3-O-sulfo-beta-D-galactosyl)-N-[(15Z)-tetracos-15-enoyl]sphingosine 
1-(3-O-sulfo-beta-D-galactosyl)-N-stearoylsphingosine 
1-(4Z,7Z,10Z,13Z,16Z,19Z-docosahexaenoyl)-sn-glycero-3-phosphocholine 
1-(5-phospho-beta-D-ribosyl)-5'-AMP 
1-(5-phospho-beta-D-ribosyl)-5-[(5-phospho-beta-D-ribosylamino)methylideneamino]imidazole-4-carboxamide 
1-(alk-1-enyl)-2-acyl-sn-glycero-3-phosphate(2-) +  
1-(alk-1-enyl)-sn-glycero-3-phosphoethanolamine +  
1-(beta-D-galactosyl)-N-behenoylsphingosine 
1-(sn-glycero-3-phospho)-1D-myo-inositol 
1-[(11Z)-octadecenoyl]-2-[(4Z,7Z,10Z,13Z,16Z,19Z)]-docosahexaenoyl-sn-glycero-3-phosphocholine 
1-[(11Z,14Z)-icosadienoyl]-2-[(4Z,7Z,10Z,13Z,16Z)-docosapentaenoyl]-sn-glycero-3-phosphoethanolamine 
1-[(1Z)-octadecenyl]-2-[(5Z,8Z,11Z,14Z)-icosatetraenoyl]-sn-glycero-3-phosphocholine 
1-[(1Z,11Z)-octadecadienyl]-2-oleoyl-sn-glycero-3-phosphoethanolamine 
1-[(1Z,11Z)-octadecadienyl]-2-palmitoyl-sn-glycero-3-phosphoethanolamine 
1-[(1Z,9Z)-octadecadienyl]-sn-glycero-3-phosphocholine 
1-[(2Z)-hexadecenoyl]-2-[(9Z)-octadecenoyl]-sn-glycero-3-phosphocholine 
1-[(7Z)-hexadecenoyl]-2-[(5Z,8Z,11Z,14Z)-eicosatetraenoyl]-sn-glycero-3-phosphocholine 
1-[(9E)-hexadecenoyl]-sn-glycero-3-phosphocholine 
1-[(9Z)-hexadecenoyl]-2-[(11Z)-octadecenoyl]-sn-glycero-3-phosphocholine 
1-[(9Z)-hexadecenoyl]-2-[(5Z,8Z,11Z,14Z)-eicosatetraenoyl]-sn-glycero-3-phosphocholine 
1-[(9Z)-hexadecenoyl]-2-[(9Z)-octadecenoyl]-sn-glycero-3-phosphocholine 
1-[(9Z)-hexadecenoyl]-2-acetyl-sn-glycero-3-phosphocholine 
1-[(9Z)-hexadecenoyl]-sn-glycero-3-phosphocholine 
1-[(9Z)-hexadecenyl]-2-acetyl-sn-glycero-3-phosphocholine 
1-[(9Z)-octadecenoyl]-2-[(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoyl]-sn-glycero-3-phosphocholine 
1-[(9Z)-octadecenoyl]-2-[(6Z,9Z)-octadecadienoyl]-sn-glycero-3-phosphocholine 
1-[(9Z)-octadecenyl]-2-[(5Z,8Z,11Z,14Z)-eicosatetraenoyl]-sn-glycero-3-phosphocholine 
1-[(9Z)-octadecenyl]-2-hexadecanoyl-sn-glycero-3-phosphocholine 
1-[(9Z,12Z)-octadecadienoyl]-2-[(5Z,8Z,11Z,14Z)-icosatetraenoyl]-sn-glycero-3-phosphocholine 
1-acyl-sn-glycero-3-phosphoethanolamine +  
1-acyl-sn-glycerol 3-phosphate +  
1-acylglycerone 3-phosphate +  
1-alkyl-sn-glycerol 3-phosphate +  
1-aminopropan-2-ol +  
1-arachidonoyl-sn-glycero-3-phosphocholine 
1-chloro-2,4,6-trinitrobenzene  
1-chloro-2,4-dinitrobenzene  
1-deoxy-D-xylulose 
1-deoxy-D-xylulose 5-phosphate 
1-docosanoyl-2-pentadecanoyl-sn-glycero-3-phosphoethanolamine 
1-docosanoyl-2-tetradecanoyl-sn-glycero-3-phosphoethanolamine 
1-dodecylpyrrolidin-2-one 
1-eicosyl-2-linolenyl-sn-glycero-3-phosphoethanolamine 
1-elaidoyl-sn-glycero-3-phosphocholine 
1-heptadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphocholine 
1-heptadecanoyl-2-[(9Z,12Z,15Z)-octadecatrienoyl]-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-(11Z-octadecenoyl)-sn-glycero-3-phosphoethanolamine 
1-hexadecanoyl-2-(4E,7E,10E,13E,16E,19E-docosahexaenoyl)-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-(4Z,7Z,10Z,13Z,16Z,19Z-docosahexaenoyl)-sn-glycero-3-phosphocholine  
1-hexadecanoyl-2-(4Z,7Z,10Z,13Z,16Z-docosapentaenoyl)-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-(5E,8E,11E,14E-eicosatetraenoyl)-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-(5Z,8Z,11Z,14Z-icosatetraenoyl)-sn-glycero-3-phospho-D-myo-inositol 
1-hexadecanoyl-2-(5Z,8Z,11Z,14Z-icosatetraenoyl)-sn-glycero-3-phosphoethanolamine 
1-hexadecanoyl-2-(7Z-octadecenoyl)-sn-glycero-3-phosphoethanolamine 
1-hexadecanoyl-2-(9,10-epoxyoctadecanoyl)-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phospho-(1'-sn-glycerol) 
1-hexadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphoethanolamine 
1-hexadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phosphoethanolamine 
1-hexadecanoyl-2-[(11Z)-octadec-9-enoyl]-sn-glycero-3-phospho-(1'-sn-glycerol) 
1-hexadecanoyl-2-[(5S,6E,8Z,11Z,14Z)-5-hydroxyicosatetraenoyl]-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-[(5Z,8Z,10E,12S,14Z)-12-hydroxyicosatetraenoyl]-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-[(7Z,10Z,13Z,16Z)-docosatetraenoyl]-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-[(7Z,10Z,13Z,16Z,19Z)-docosapentaenoyl]-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-[(9Z)-octadec-9-enoyl]-sn-glycero-3-phospho-(1'-sn-glycerol) 
1-hexadecanoyl-2-icosanoyl-sn-glycero-3-phosphoethanolamine 
1-hexadecanoyl-2-methyl-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-octadecanoyl-sn-glycero-3-phosphocholine 
1-hexadecanoyl-sn-glycero-3-phosphocholine +  
1-hexadecyl-2-formyl-sn-glycero-3-phosphocholine 
1-icosanoyl-2-hexadecanoyl-sn-glycero-3-phosphocholine 
1-icosanoyl-2-tetradecanoyl-sn-glycero-3-phosphocholine 
1-icosanoyl-sn-glycero-3-phosphoethanolamine 
1-linoleoyl-sn-glycero-3-phosphocholine 
1-methoxyphenanthrene 
1-methyl-2-hexadecanoyl-sn-glycero-3-phosphocholine 
1-methyl-7H-xanthine +   
1-methylimidazole-4-acetaldehyde 
1-methylnicotinamide +   
1-methylpyrrolinium 
1-methyluric acid  
1-myristoyl-2-linoleoyl-sn-glycerol 
1-myristoyl-2-oleoyl-sn-glycerol +  
1-myristoyl-2-palmitoleoyl-sn-glycero-3-phosphocholine 
1-myristoyl-2-palmitoleoyl-sn-glycerol 
1-myristoyl-2-palmitoyl-sn-glycero-3-phosphocholine 
1-myristoyl-2-palmitoyl-sn-glycerol 
1-naphthaldehyde  
1-nitronaphthalene  
1-O-(1-O-hexadecanoyl-2-O-heptadecanoyl-sn-glycero-3-phosphono)-1D-myo-inositol 
1-O-(alpha-D-galactopyranosyl)-N-hexacosanoylsphinganine 
1-O-(alpha-D-galactopyranosyl)-N-pamitoylphytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-tetracosanyl-2-aminononane-1,3,4-triol 
1-O-(alpha-D-galactopyranuronosyl)-N-tetradecanoyldihydrosphingosine 
1-O-(alpha-D-galactosyl)-N-hexacosanoylphytosphingosine +   
1-O-(alpha-D-glucosyl)-29-keto-(3R,31R)-dotriacontanetriol 
1-O-[6-O-(3-phenylpropanoyl)-alpha-D-galactopyranosyl]-N-hexacosanoylsphinganine 
1-O-[6-O-(3-phenylpropanoyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-acyl-sn-glycero-3-phosphocholine(1+) +  
1-O-dodecanoyl-2-O-pentacosanoyl-sn-glycero-3-phosphocholine 
1-O-palmitoyl-2-O-[1-(14)C]-linoleoyl-sn-glycero-3-phosphocholine 
1-octadecadienyl-2-icosatetraenoyl-sn-glycero-3-phosphoethanolamine 
1-octadecanoyl-2-(4Z,7Z,10Z,13Z,16Z,19Z-docosahexaenoyl)-sn-glycero-3-phosphocholine 
1-octadecanoyl-2-(5E,8E,11E,14E-eicosatetraenoyl)-sn-glycero-3-phosphoethanolamine 
1-octadecanoyl-2-(7Z,10Z,13Z,16Z)-docosatetraenoyl-sn-glycero-3-phosphoethanolamine 
1-octadecanoyl-2-(7Z,10Z,13Z,16Z-docosatetraenoyl)-sn-glycero-3-phosphocholine 
1-octadecanoyl-2-[(10Z,12Z)-octadecadienoyl]-sn-glycero-3-phosphocholine 
1-octadecanoyl-2-[(2E,4E)-octadecadienoyl]-sn-glycero-3-phosphocholine 
1-octadecanoyl-2-[(4Z,7Z,10Z,13Z,16Z)-docosapentaenoyl]-sn-glycero-3-phosphoethanolamine 
1-octadecanoyl-2-[(6Z,9Z)-octadecadienoyl]-sn-glycero-3-phosphocholine 
1-octadecanoyl-2-[(8Z,10Z,12Z,14Z)-eicosatetraenoyl]-sn-glycero-3-phosphocholine 
1-octadecanoyl-2-[(9Z)-octadecenoyl]-sn-glycerol +   
1-octadecanoyl-2-[(9Z,11Z,13Z,15Z,17Z,19E)-docosahexaenoyl]-sn-glycero-3-phosphocholine 
1-octadecanoyl-2-[(9Z,12Z)-octadecadienoyl]-sn-glycero-3-phosphocholine 
1-octadecanoyl-2-octadecenoyl-sn-glycero-3-phosphocholine +  
1-octadecanoyl-2-pentadecanoyl-sn-glycero-3-phosphocholine 
1-octadecenoyl-2-icosatetraenoyl-sn-glycero-3-phosphoethanolamine 
1-octadecenoyl-2-octadecadienoyl-sn-glycero-3-phospho-(1'-sn-glycerol) 
1-oleoyl-2,3-di-linoleoyl-sn-glycerol 
1-oleoyl-2-(4Z,7Z,10Z,13Z,16Z,19Z-docosahexaenoyl)-sn-glycerol 
1-oleoyl-2-(7Z,10Z,13Z,16Z-docosatetraenoyl)-sn-glycerol 
1-oleoyl-2-(8Z,11Z,14Z-eicosatrienoyl)-sn-glycerol 
1-oleoyl-2-(alpha-linolenoyl)-sn-glycerol 
1-oleoyl-2-arachidonoyl-sn-glycero-3-phosphocholine 
1-oleoyl-2-arachidonoyl-sn-glycerol 
1-oleoyl-2-gondoyl-sn-glycerol 
1-oleoyl-2-linoleoyl-sn-glycero-3-phosphocholine 
1-oleoyl-2-linoleoyl-sn-glycerol 
1-oleoyl-2-linoleyl-sn-glycero-3-phosphoethanolamine 
1-palmitoleoyl-2-linoleoyl-sn-glycero-3-phosphocholine 
1-palmitoleoyl-2-linoleoyl-sn-glycerol 
1-palmitoleoyl-2-stearoyl-sn-glycero-3-phosphocholine 
1-palmitoleoyl-2-stearoyl-sn-glycerol 
1-palmitoyl-2,3-dioleoyl-sn-glycerol +  
1-palmitoyl-2-(11Z,14Z-eicosadienoyl)-sn-glycero-3-phosphocholine 
1-palmitoyl-2-(11Z,14Z-eicosadienoyl)-sn-glycerol 
1-palmitoyl-2-(11Z-eicosenoyl)-sn-glycero-3-phosphocholine 
1-palmitoyl-2-(7Z,10Z,13Z,16Z-docosatetraenoyl)-sn-glycero-3-phosphoethanolamine 
1-palmitoyl-2-(7Z,10Z,13Z,16Z-docosatetraenoyl)-sn-glycerol 
1-palmitoyl-2-(8Z,11Z,14Z-eicosatrienoyl)-sn-glycerol 
1-palmitoyl-2-(9Z-heptadecenoyl)-sn-glycero-3-phosphocholine 
1-palmitoyl-2-[(6Z,9Z,12Z)-octadecatrienoyl]-sn-glycero-3-phosphocholine 
1-palmitoyl-2-[(9Z,12Z,15Z)-octadecatrienoyl]-sn-glycero-3-phosphocholine 
1-palmitoyl-2-arachidonoyl-sn-glycero-3-phospho-(1'-sn-glycerol) 
1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine  
1-palmitoyl-2-linoleoyl-3-oleoyl-sn-glycerol 
1-palmitoyl-2-linoleoyl-sn-glycerol 
1-palmitoyl-2-octadecadienoyl-sn-glycero-3-phosphocholine 
1-palmitoyl-2-oleoyl-sn-glycerol +   
1-palmitoyl-2-palmitoleoyl-sn-glycero-3-phosphocholine 
1-palmitoyl-2-palmitoleoyl-sn-glycerol 
1-palmitoyl-2-stearoyl-sn-glycero-3-phosphoserine 
1-pentadecanoyl-2-docosanoyl-sn-glycero-3-phosphoethanolamine 
1-pentadecanoyl-2-octadecanoyl-sn-glycero-3-phosphocholine 
1-pentadecyl-2-acetyl-sn-glycero-3-phosphocholine 
1-phenanthrol +  
1-phenylethanol +  
1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphate +  
1-phosphatidyl-1D-myo-inositol 3,4-bisphosphate +  
1-phosphatidyl-1D-myo-inositol 3-phosphate +  
1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate +  
1-phosphatidyl-1D-myo-inositol 4-phosphate +  
1-stearoyl-2-(7Z,10Z,13Z,16Z-docosatetraenoyl)-sn-glycero-3-phosphoserine 
1-stearoyl-2-(7Z,10Z,13Z,16Z-docosatetraenoyl)-sn-glycerol 
1-stearoyl-2-(8Z,11Z,14Z-icosa-8,11,14-trienoyl)-sn-glycerol 
1-stearoyl-2-(8Z,11Z,14Z-icosatrienoyl)-sn-glycero-3-phosphoserine 
1-stearoyl-2-arachidonoyl-sn-glycero-3-phospho-1D-myo-inositol 
1-stearoyl-2-arachidonoyl-sn-glycero-3-phosphocholine +  
1-stearoyl-2-arachidonoyl-sn-glycero-3-phosphoethanolamine 
1-stearoyl-2-linoleoyl-sn-glycero-3-phospho-1D-myo-inositol 
1-stearoyl-2-linoleoyl-sn-glycero-3-phospho-L-serine 
1-stearoyl-2-linoleoyl-sn-glycerol  
1-stearoyl-2-oleoyl-sn-glycero-3-phosphoserine +  
1-stearoyl-sn-glycero-3-phosphocholine  
1-tetradecanoyl-2-(11Z-octadecenoyl)-sn-glycero-3-phosphocholine 
1-tetradecanoyl-2-[(9Z)-octadecenoyl]-sn-glycero-3-phosphocholine 
1-tetradecanoyl-2-docosanoyl-sn-glycero-3-phosphoethanolamine 
10-formyltetrahydrofolic acid +   
11(R)-HPETE 
11(S)-HETE 
11,12,15-trihydroxy-(5Z,8Z,13E)-icosatrienoic acid 
11,12-EET +  
11,14,15-trihydroxy-(5Z,8Z,12E)-icosatrienoic acid 
11-cis-retinal +  
11-cis-retinol +  
11-dehydrocorticosterone  
11-deoxycorticosterone +   
11-deoxycortisol  
11-HETE +  
11beta,17alpha,21-trihydroxypregnenolone 
11beta-hydroxyandrost-4-ene-3,17-dione 
11beta-hydroxyprogesterone 
12(R)-HPETE +  
12(S)-HEPE 
12(S)-HPETE +   
12-HEPE +  
12-oxo-ETE 
13(S)-HODE 
13(S)-HOTrE 
13-oxo-9Z,11E-ODE 
14,15-EET +   
14-demethyllanosterol +   
15(R)-HEPE 
15(R)-HEPE(1-) 
15(S)-HETE 
15(S)-HETrE 
15(S)-HPETE +  
15-acetyldeoxynivalenol  
15-dehydroprostaglandin A1 
15-deoxy-Delta(12,14)-prostaglandin J3 
15-HEPE +  
16(R)-HETE 
16alpha-hydroxyandrost-4-ene-3,17-dione 
16alpha-hydroxydehydroepiandrosterone 
16alpha-hydroxyestrone +  
17(R)-HDoHE 
17(R)-HDoHE(1-) 
17(S)-HDoHE 
17alpha,21-dihydroxypregnenolone 
17alpha-hydroxypregnenolone +   
17alpha-hydroxyprogesterone  
17beta-estradiol +   
17beta-estradiol 3-glucosiduronic acid  
17beta-estradiol 6-O-(carboxymethyl)oxime 
17beta-hydroxy-5alpha-androstan-3-one +   
18(R)-HEPE 
18(R)-HEPE(1-) 
18-hydroxycorticosterone 
18-hydroxyleukotriene B4 
19(S)-HETE  
19-hydroxyandrost-4-ene-3,17-dione 
19-hydroxyleukotriene B4 
19-hydroxytestosterone 
1D-myo-inositol 1,2-cyclic phosphate 
1D-myo-inositol 1,3,4,5-tetrakisphosphate 
1D-myo-inositol 1,3,4-trisphosphate 
1D-myo-inositol 1,4,5,6-tetrakisphosphate 
1D-myo-inositol 1,4,5-trisphosphate +   
1D-myo-inositol 1,4-bisphosphate 
1D-myo-inositol 1-phosphate  
1D-myo-inositol 3,4,5,6-tetrakisphosphate 
1D-myo-inositol 3,4-bisphosphate 
1D-myo-inositol 3-phosphate 
1D-myo-inositol 4-phosphate 
1H-indole +   
2',3'-cyclic AMP 
2',3'-cyclic CMP 
2',3'-cyclic GMP +  
2',3'-cyclic UMP 
2'-aminobiphenyl-2,3-diol 
2'-deoxyadenosine +   
2'-deoxycytidine +   
2'-deoxycytosine 5'-monophosphate +   
2'-deoxyguanosine +   
2'-deoxyguanosine 5'-monophosphate +   
2'-deoxyinosine 
2'-deoxyinosine-5'-diphosphate 
2'-deoxyinosine-5'-monophosphate 
2'-deoxyuridine +  
2,2',3-trihydroxydiphenyl ether 
2,2,2-trichloroethanol  
2,3,2',3'-tetrakis(3-hydroxytetradecanoyl)-alpha-D-glucosaminyl-1,6-beta-D-glucosamine 1-phosphate +  
2,3,4,5-tetrahydrodipicolinic acid +  
2,3-bis-O-(geranylgeranyl)-sn-glycero-3-phosphoethanolamine 
2,3-bisphospho-D-glyceric acid  
2,3-didehydro-gibberellin A9 
2,3-dihydroxy-DDT +  
2,3-dihydroxy-trans-cinnamic acid 
2,3-dihydroxybenzoyl 5'-adenylate 
2,3-diketogulonic acid 
2,4,6-trinitrobenzenesulfonic acid  
2,4,6-trinitrophenyl group +  
2,4-dinitrophenyl group +  
2,5-diamino-6-ribosylamino-4(3H)pyrimidinone 5'-triphosphate 
2,5-didehydro-D-gluconic acid 
2,5-dihydroxybenzaldehyde  
2,5-dihydroxybenzoic acid +   
2,6-di-O-(alpha-D-mannosyl)-1-O-(1,2-di-O-hexadecanoyl-sn-glycero-3-phosphono)-1D-myo-inositol 
2,6-diaminopimelate(2-) +  
2,6-diaminopimelic acid +  
2,6-dihydroxycyclohexane-1-carbonyl-CoA 
2-(acetylamino)naphthalene-1,5-disulfonic acid 
2-(alpha-D-mannosyl)-D-glyceric acid +  
2-[(11R)-hydroxy-(5Z,8Z,12E,14Z)-icosatetraenoyl]-sn-glycero-3-phosphocholine 
2-[(11Z,14Z)-icosadienoyl]-sn-glycero-3-phosphoethanolamine 
2-[(15R)-hydroxy-(5Z,8Z,11Z,13E)-icosatetraenoyl]-sn-glycero-3-phosphocholine 
2-[(15S)-hydroxy-(5Z,8Z,11Z,13E)-icosatetraenoyl]-sn-glycero-3-phosphocholine 
2-[(5Z,13E,15S)-11alpha,15-dihydroxy-9-oxoprosta-5,13-dien-1-oyl]-sn-glycero-3-phosphocholine 
2-[(5Z,13E,15S)-11alpha,15-dihydroxy-9-oxoprosta-5,13-dien-1-oyl]-sn-glycero-3-phosphoethanolamine 
2-[(5Z,8Z,11Z)-icosatrienoyl]-sn-glycero-3-phosphoethanolamine 
2-[(9S,11R)-epidioxy-(15S)-hydroperoxy-(5Z,13E)-prostadienoyl]-sn-glycero-3- phosphocholine 
2-[(9S,11R)-epidioxy-(15S)-hydroperoxy-(5Z,13E)-prostadienoyl]-sn-glycero-3-phosphoethanolamine 
2-[(9S,11R)-epidioxy-(15S)-hydroxy-(5Z,13E)-prostadienoyl]-sn-glycero-3- phosphocholine 
2-[(9S,11R)-epidioxy-(15S)-hydroxy-(5Z,13E)-prostadienoyl]-sn-glycero-3-phosphoethanolamine 
2-\{[(R)-\{[4-(aminomethyl)phenyl]amino\}\{[(1R)-1-phenylethyl]amino\}methyl]amino\}ethane-1,1-diol 
2-acetamido-2-deoxy-D-glucopyranose 1-phosphate +  
2-acetamidofluorene +   
2-acetyllactic acid +  
2-acyl-sn-glycero-3-phosphate +  
2-acyl-sn-glycero-3-phosphocholine(1+) +  
2-acyl-sn-glycero-3-phosphoethanolamine +  
2-amino-2-deoxy-beta-D-galactopyranose 
2-amino-2-deoxy-D-glucopyranose +   
2-amino-3-oxoadipic acid 
2-aminoacetaldehyde 
2-aminoacrylic acid +  
2-aminoethanesulfonate 
2-aminomuconic 6-semialdehyde 
2-aminomuconic acid 
2-C-methyl-D-erythritol 2,4-cyclic diphosphate 
2-C-methyl-D-erythritol 4-(dihydrogen phosphate) 
2-cis,6-trans,10-trans-geranylgeranyl diphosphate 
2-dehydro-3-deoxy-6-phospho-D-gluconic acid 
2-dehydro-3-deoxy-D-galactonic acid 
2-dehydro-3-deoxy-D-gluconic acid 
2-demethylmenaquinone +  
2-deoxy-D-glucose 6-phosphate 
2-deoxy-D-ribofuranose 
2-deoxy-D-ribose +  
2-endo-amino-2-exo-benzoyl-3-exo-phenylnorbornane 
2-formamido-N(1)-(5-phospho-D-ribosyl)acetamidine 
2-formylbenzoate 
2-formylbenzoic acid 
2-hexaprenyl-6-methoxy-1,4-benzoquinone 
2-hexaprenyl-6-methoxy-3-methyl-1,4-benzoquinone 
2-hexaprenyl-6-methoxyphenol 
2-hydroxy-1,4-benzoquinone 
2-hydroxy-17beta-estradiol +   
2-hydroxy-3-(4-hydroxyphenyl)prop-2-enoic acid 
2-hydroxy-3-oxobutyl phosphate +  
2-hydroxy-3-oxopropanoic acid 
2-hydroxy-4-isopropenylcyclohexane-1-carbonyl-CoA 
2-hydroxy-6-oxocyclohexane-1-carbonyl-CoA 
2-hydroxyglutaric acid +   
2-hydroxyhepta-2,4-dienedioic acid 
2-hydroxypropylphosphonic acid +  
2-icosanoyl-sn-glycero-3-phosphoethanolamine 
2-isopropylmaleic acid 
2-methoxy-17beta-estradiol +   
2-methoxy-17beta-estradiol 3-O-(beta-D-glucuronide) 
2-methoxy-6-(all-trans-octaprenyl)phenol 
2-methoxyestrone +   
2-methoxyestrone 3-O-(beta-D-glucuronide) 
2-methyl-1-hydroxypropylthiamine diphosphate 
2-methylacetoacetyl-CoA 
2-methylpropane-1,2-diol 
2-naphthaldehyde 
2-naphthoic acid +   
2-naphthol +   
2-naphthoyl-CoA 
2-O-sulfate-4-hydroxyacetophenone 
2-octaprenylphenol 
2-oxoadipic acid  
2-phenylacetamide 
2-phenylethanaminium 
2-phenylethylamine +   
2-phospho-D-glyceric acid 
2-phosphoglycerate(3-) 
2-phosphoglycolic acid 
2-trans,6-trans,10-trans-geranylgeranyl diphosphate  
2-trans,6-trans-farnesyl diphosphate +   
2-trimethylaminoethylphosphonic acid 
20-HETE +   
20-hydroxy-leukotriene B4 
20-hydroxycholesterol  
21-deoxycortisol 
21-HDoHE 
21-hydroxypregnenolone +  
23-acetoxysoladulcidine 
24,25-dihydrolanosterol +   
24-methylenecholesterol +  
24-methylidenelophenol +  
24G7 epitope +   
3',4'-O-disulfo-N-acetyllactosamine 
3',5'-cyclic AMP +   
3',5'-cyclic GMP +   
3'-AMP 
3'-AMP(2-) 
3'-CMP  
3'-dephospho-CoA 
3'-ketolactose 
3'-phospho-5'-adenylyl sulfate  
3'-phosphoadenylyl selenate 
3'-UMP +  
3,3',5-triiodo-L-thyronine +   
3,3-dimethylcystein-S-yl group 
3,4-di-O-methyl-alpha-L-rhamnose 
3,4-dichloroaniline +   
3,4-dihydro-4-[(5-methyl-2-furanyl)methylene]-2H-pyrrole 
3,4-dihydroxyfluorene 
3,4-dihydroxymandelaldehyde 
3,4-dihydroxymandelic acid  
3,4-dihydroxyphenylacetaldehyde  
3,4-dihydroxyphenylethyleneglycol  
3,5-dibromocatechol 
3,5-diiodo-L-tyrosine +  
3,6-di-O-sulfo-beta-D-galactosyl-(1->4)-6-O-sulfo-N-acetyl-beta-D-glucosamine 
3,6-di-O-sulfo-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
3,7-dimethyluric acid 
3-(3-hydroxyphenyl)propanoic acid +  
3-(4-oxo-4,5-dihydro-1H-imidazol-5-yl)propanoic acid 
3-(5-methylfurfuryl)pyrrole 
3-(all-trans-octaprenyl)benzene-1,2-diol 
3-(imidazol-4-yl)-2-oxopropyl dihydrogen phosphate 
3-(imidazol-5-yl)lactic acid +  
3-[alpha-D-galactosyl-(1->6)-beta-D-galactosyl]-1,2-diacyl-sn-glycerol +  
3-\{[(5-nitrofuran-2-yl)methylidene]amino\}-1,3-oxazol-2-one 
3-acetyldeoxynivalenol  
3-aminoalanine +  
3-carboxy-1-hydroxypropylthiamine diphosphate 
3-cyano-L-alanine +  
3-dehydro-4-methylzymosterol +  
3-dehydro-L-gulonic acid +  
3-dehydro-L-gulonic acid 6-phosphate 
3-dehydroquinic acid 
3-dehydrosphinganine +  
3-demethylubiquinone-6 
3-disulfanyl-L-alanine +  
3-hexaprenyl-4,5-dihydroxybenzoic acid 
3-hexaprenyl-4-hydroxy-5-methoxybenzoic acid 
3-hexaprenyl-4-hydroxybenzoic acid 
3-hydroxy-5-oxohexanoyl-CoA 
3-hydroxy-L-kynurenine 
3-hydroxy-N(6),N(6),N(6)-trimethyl-L-lysine 
3-hydroxyanthranilate 
3-hydroxyanthranilic acid 
3-hydroxybutanoyl-CoA +  
3-hydroxydecanoic acid 
3-hydroxyisovaleryl-CoA 
3-hydroxyoctadecanoyl-CoA +  
3-hydroxypimeloyl-CoA 
3-hydroxypropanoyl-CoA 
3-hydroxypropionic acid +   
3-hydroxypyruvic acid  
3-iodo-L-tyrosine +  
3-keto-beta-D-galactose 
3-mercaptolactic acid 
3-mercaptopyruvic acid 
3-methylbut-2-enoyl-CoA 
3-O-\{(1R)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl\}-2,6-bis-O-\{(1S)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl\}-beta-D-Man-(1->4) -beta-D-GlcNAc-(1->4)-3-O-[(1S)-2-hydroxy-1-\{[(2S)-1-hydroxypropan-2-yl]oxy\}ethyl]-D-GlcNAc-yl group 
3-O-alpha-abequopyranosyl-alpha-D-mannopyranose 
3-O-methyl-alpha-L-rhamnose 
3-O-sulfo-beta-D-galactose +  
3-oxo-N-[(3S)-2-oxopyrrolidin-3-yl]dodecanamide 
3-oxoadipyl-CoA 
3-oxodecanoyl-CoA 
3-oxohexanoyl-CoA 
3-oxolauroyl-CoA 
3-oxooctadecanoyl-CoA 
3-oxooctanoyl-CoA 
3-oxopalmitoyl-[acyl-carrier protein] 
3-oxopalmitoyl-CoA 
3-oxopimeloyl-CoA 
3-oxotetradecanoyl-CoA 
3-phospho-D-glyceric acid 
3-phospho-D-glyceroyl dihydrogen phosphate 
3-phosphoshikimic acid 
3-sulfino-L-alanine +  
3-sulfinylpyruvic acid 
3-sulfopyruvic acid 
3-ureidoisobutyric acid 
3alpha,7alpha,12alpha,24-tetrahydroxy-5beta-cholestan-26-oyl-CoA +  
3alpha,7alpha,12alpha-trihydroxy-24-oxo-5beta-cholestan-26-oyl-CoA 
3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-en-26-oyl-CoA +  
3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl-CoA +  
3alpha,7alpha,24-trihydroxy-5beta-cholestan-26-oyl-CoA 
3alpha,7alpha-dihydroxy-24-oxo-5beta-cholestan-26-oyl-CoA 
3alpha,7alpha-dihydroxy-5beta-cholest-24-enoyl-CoA 
3alpha,7alpha-dihydroxy-5beta-cholestan-26-al 
3alpha,7alpha-dihydroxy-5beta-cholestan-26-oic acid +  
3alpha,7alpha-dihydroxy-5beta-cholestan-26-oyl-CoA +  
3alpha-hydroxy-5beta-androstan-17-one +   
3alpha-hydroxy-5beta-androstan-17-one 3-glucosiduronic acid 
3beta-hydroxy-5beta-pregnan-20-one 
3beta-hydroxyatractylon 
4'-hydroxyacetophenone +   
4,4'-dihydroxy-alpha-methylstilbene 
4,4-dimethyl-5alpha-cholest-8-en-3beta-ol 
4,4-dimethyl-5alpha-cholesta-8,14,24-trien-3beta-ol  
4,6-di-O-sulfo-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp2Me-(1->2)-4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-ManpOMe 
4-(1-hydroxyethyl)phenol 
4-(18,20-dihydroxy-26-methoxy-25-methyloctacosyl)phenyl 3,6-di-O-methyl-beta-D-Glc-(1->4)-2,3-di-O-methyl-alpha-L-Rha-(1->2)-3-O-methyl-alpha-L-Rha 
4-(2-aminophenyl)-2,4-dioxobutanoic acid 
4-(2-carboxyphenyl)-4-oxobutanoyl-CoA 
4-(4-styrylphenylcarbamoyl)butyric acid 
4-(\{5-[(2-aminoethyl)amino]-2,4-dinitrophenyl\}amino)-TEMPO 
4-(L-gamma-glutamylamino)butanoic acid 
4-(phosphonooxy)-L-threonine 
4-(trimethylammonio)butanoate  
4-(trimethylammonio)butanoic acid +  
4-[(1S,2R)-3-(4-fluorophenyl)-2-hydroxy-1-(1,2,4-triazol-1-yl)propyl]benzonitrile 
4-[N'-(2-hydroxyethyl)thioureido]-L-benzyl EDTA 
4-acetamidobutanal 
4-amino-2-methyl-5-diphosphooxymethylpyrimidine 
4-amino-2-methyl-5-phosphooxymethylpyrimidine 
4-amino-5-hydroxymethyl-2-methylpyrimidine 
4-aminobenzoate 
4-aminobenzoic acid +   
4-aminobutanal 
4-aminobutyl beta-D-xylopyranoside 
4-bromophenol 
4-CDP-2-C-methyl-D-erythritol 
4-CDP-2-C-methyl-D-erythritol 2-phosphate 
4-guanidinobutanoic acid 
4-hydroxy-1-pyrroline-2-carboxylic acid +  
4-hydroxy-2-oxopentanoic acid +  
4-hydroxy-8-methoxyquinaldic acid 
4-hydroxy-L-threonine 
4-hydroxybenzaldehyde 
4-hydroxyphenyl acetate 
4-hydroxyphenylacetic acid +   
4-hydroxyphenylacetyl-CoA 
4-hydroxyphenylacetylglycine 
4-isopropenyl-2-oxocyclohexane-1-carbonyl-CoA 
4-methyl-1,4-dihydropyridine-3,5-dicarbaldehyde 
4-methyl-5-(2-phosphonooxyethyl)thiazole +  
4-methylpentanal  
4-nitrophenol +   
4-nitrophenyl (4-carboxybutyl)phosphonate 
4-nitrophenyl methylphosphonate 
4-nitrophenyl phosphate  
4-O-(2-acetamido-2-deoxy-beta-D-glucopyranosyl)-5-O-phosphono-D-ribitol 
4-O-(2-acetamido-2-deoxy-beta-D-glucopyranosyl)-D-ribitol +  
4-O-acetyl-2,3-di-O-methyl-alpha-L-fucopyranose 
4-phospho-D-erythronic acid 
4-phospho-L-aspartic acid +  
4-pregnen-20,21-diol-3-one 
4-pyridoxic acid +   
4-trimethylammoniobutanal 
4alpha-methyl-5alpha-ergosta-8,14,24(28)-trien-3beta-ol 
4alpha-methylzymosterol +  
4beta-methylzymosterol-4alpha-carboxylic acid 
5'-acetylphosphoadenosine 
5'-adenylyl sulfate +   
5'-CGAAAGUCCGAUCGGCGUAAUGUCA-3' RNA fragment 
5'-CGTGCTGTTTTTTTTTG-3' 
5'-CGUUCGCG-3' RNA fragment 
5'-deoxyadenosine 
5'-GACCCCUG-3' RNA fragment 
5'-GUUUGGCGACGUCCCACAUGAGCC-3' RNA fragment 
5'-S-methyl-5'-thioadenosine  
5'-TCGAGCTGCCTTCAGTCGT-3' 
5'-xanthylic acid +  
5(S)-HETE 
5(S)-HPETE 
5,6,7,8-tetrahydrofolyl-L-glutamic acid 
5,6,7,8-tetrahydropteridine 
5,6-DHET 
5,6-dihydrothymine 
5,6-dihydrouracil 
5,6-dihydroxyindole 
5,6-dihydroxyindole-2-carboxylic acid  
5,6-dimethylbenzimidazole 
5,6-EET +   
5,6beta-epoxy-5beta-cholestane 
5,7-icosanedione 
5-(2-amino-5,6-dimethyl-1H-benzimidazol-1-yl)pentanoic acid 
5-(2-hydroxyethyl)-4-methylthiazole 
5-(\{4-[2-(1-oxidopiperidin-1-yl)ethyl]phenyl\}amino)-5-oxopentanoic acid 
5-(hydroxymethyl)cytosine +   
5-[(4,6-diamino-1,3,5-triazin-2-yl)amino]-4-hydroxy-3-[(2-sulfophenyl)diazenyl]naphthalene-2,7-disulfonic acid 
5-[(4-nitrobenzyl)(phosphonomethyl)amino]valeric acid 
5-[(5-phospho-1-deoxy-D-ribulos-1-ylimino)methylamino]-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide 
5-acetamido-6-formamido-3-methyluracil  
5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylic acid 
5-amino-2-chlorobenzotrifluoride 
5-amino-6-(5-phospho-beta-D-ribosylamino)uracil 
5-amino-6-(5-phospho-D-ribitylamino)uracil 
5-amino-6-(D-ribitylamino)uracil 
5-aminoimidazole-4-carboxamide  
5-aminolevulinic acid +   
5-carboxyamino-1-(5-phospho-D-ribosyl)imidazole 
5-dehydro-D-gluconic acid 
5-formamido-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide 
5-formimidoyltetrahydrofolic acid 
5-formyltetrahydrofolic acid +   
5-guanidino-2-oxopentanoic acid 
5-HEPE 
5-HETE +  
5-hydroxy-2-oxo-4-ureido-2,5-dihydro-1H-imidazole-5-carboxylic acid 
5-hydroxy-L-tryptophan 
5-hydroxyisouric acid +  
5-hydroxykynurenamine +  
5-methyldihydrofolic acid 
5-O-(1-carboxyvinyl)-3-phosphoshikimic acid 
5-O-phosphono-alpha-D-ribofuranosyl diphosphate 
5-oxo-ETE  
5-phospho-beta-D-ribosylamine 
5alpha-androstane-3,17-dione 
5alpha-cholest-7-en-3beta-ol +   
5alpha-cholest-8-en-3beta-ol 
5alpha-cholesta-7,24-dien-3beta-ol 
5beta-androstane-3,17-dione 
5beta-cholestane-3alpha,7alpha,12alpha,26-tetrol +  
5beta-cholestane-3alpha,7alpha,12alpha-triol 
5beta-cholestane-3alpha,7alpha,26-triol 
5beta-cholestane-3alpha,7alpha-diol 
5beta-dihydroaldosterone 
5beta-dihydrocorticosterone 
5beta-dihydrotestosterone 
5beta-pregnane-3,20-dione 
6,7-dimethyl-8-(1-D-ribityl)lumazine 
6,8-icosanedione 
6-(alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol +  
6-(alpha-D-glucosaminyl)-1D-myo-inositol 
6-(alpha-D-glucosaminyl)-1D-myo-inositol 1,2-cyclic phosphate 
6-(alpha-D-glucosaminyl)-O-acyl-1-phosphatidyl-1D-myo-inositol 
6-(N-acetyl-alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol 
6-[(1,2-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1,3-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1,4-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1,5-dideoxy-D-ribityl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(1-deoxy-D-ribityl)methyl]-5-[(1E)-3-oxobut-1-en-1-yl]uracil 
6-[(2-hydroxyethyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(3-hydroxypropyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(4-aminobenzyl)amino]-2,3,4,5-tetrahydropyridinium 
6-[(4-hydroxybutyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[(5-hydroxypentyl)amino]-5-[(E)-(2-oxopropylidene)amino]uracil 
6-[6-(2-aminoethylphosphoryl)-alpha-mannosyl-(1->6)-2-(2-aminoethylphosphoryl)-alpha-mannosyl-(1->6)-alpha-2-(2-aminoethylphosphoryl)mannosyl-(1->4)-alpha-glucosaminyl]-O-acyl-1-phosphatidyl-1D-myo-inositol +  
6-\{4-[hydroxy-(4-nitrophenoxy)phosphoryl]butyrylamino\}hexanoic acid 
6-deoxy-alpha-L-Talp2,3Ac2-(1->3)-beta-D-Glcp-yl group 
6-deoxy-alpha-L-Talp2Ac3Me-(1->3)-beta-D-Glcp-yl group 
6-hydroxymelatonin  
6-hydroxynicotinic acid 
6-lactoyl-5,6,7,8-tetrahydropterin +  
6-methyl-5-[(1E)-3-oxobut-1-en-1-yl]uracil 
6-O-[alpha-D-mannosyl-(1->4)-alpha-D-glucosaminyl]-O-acyl-1-phosphatidyl-1D-myo-inositol 
6-O-\{2-O-[(2-aminoethyl)phosphoryl]-alpha-D-mannosyl-(1->4)-alpha-D-glucosaminyl\}-O-acyl-1-phosphatidyl-1D-myo-inositol 
6-O-\{alpha-D-mannosyl-(1->2)-alpha-D-mannosyl-(1->6)-2-O-[(2-aminoethyl)phosphoryl]-alpha-D-mannosyl-(1->4)-alpha-D-glucosaminyl\}-O-acyl-1-phosphatidyl-1D-myo-inositol 
6-O-\{alpha-D-mannosyl-(1->6)-2-O-[(2-aminoethyl)phosphoryl]-alpha-D-mannosyl-(1->4)-alpha-D-glucosaminyl\}-O-acyl-1-phosphatidyl-1D-myo-inositol 
6-O-phosphono-D-glucono-1,5-lactone 
6-oxoprostaglandin F1alpha  
6-phospho-2-dehydro-3-deoxy-D-galactonic acid 
6-phospho-2-dehydro-D-gluconic acid 
6beta-hydroxyestrone 
7,10,13,16-docosatetraenoic acid 
7,8-dihydro-7-hydroxy-8S-glutathionylbenzo[a]pyrene 
7,8-dihydroneopterin +  
7,8-dihydroneopterin 3'-phosphate 
7,8-dihydroneopterin 3'-triphosphate 
7,9-dihydro-1H-purine-2,6,8(3H)-trione +   
7-cyano-7-deazaguanine 
7-dehydrodesmosterol 
7-methyl-3-oxooct-6-enoyl-CoA 
7-methylxanthine 
7-phospho-2-dehydro-3-deoxy-D-arabino-heptonic acid 
7alpha -hydroxytestosterone 
7alpha,12alpha-dihydroxy-5beta-cholestan-3-one 
7alpha,12alpha-dihydroxycholest-4-en-3-one 
7alpha-hydroxy-5beta-cholestan-3-one 
7alpha-hydroxycholest-4-en-3-one  
7alpha-hydroxycholesterol  
8(S),15(S)-DiHETE 
8(S),15(S)-DiHPETE 
8(S)-HPETE 
8,11,14-icosatrien-5-ynoic acid 
8,9-EET +   
8-(2-hydroxyethyl)-6-methyllumazine 
8-benzyl-7-hydroxy-4,10-dioxo-1-phenyl-6-oxa-3,9-diaza-7-phosphatetradecan-14-oic acid 7-oxide 
8-HETE +  
8-phospho-3-deoxy-D-manno-oct-2-ulosonic acid 
9(S)-HPETE 
9(S)-HPODE 
9-deoxy-9-acetamido-alpha-N-acetylneuraminyl-(2->6)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
9-deoxy-9-acetamido-N-acetyl-alpha-neuraminic acid 
9-HODE +   
9-mercaptodethiobiotin 
9xi-episterol +  
[3)-6-deoxy-alpha-L-Talp-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp2,4Ac2-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp2Ac-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp2Me-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp4Ac2Me-(1->3)-beta-D-Glcp-(1->]n 
[3)-alpha-D-Galp-(1->3)-beta-D-Galf2Ac-(1->]n 
[3)-beta-D-Glcp-(1->]5 
[3)-beta-D-Glcp6,NAc2-(1->] residue 
[3)-beta-D-GlcpNAc-(1->4)-alpha-L-Rhap-(1->]n 
[4)-alpha-D-GalNAcAN-(1->4)-alpha-D-GalNAcAN-(1->3)-beta-D-QuiNAc-(1->2)-beta-D-QuiN4Fm-(1->4)-alpha-D-GalNAcAN-(1->4)-alpha-D-GalNAcAN-(1->]n 
[4)-alpha-D-Galp-(1->3)-beta-D-Galf-(1->]n 
[4)-alpha-D-Glcp-(1->4)-alpha-D-Glcp-(1->4)-alpha-D-Glcp-(1->] residue 
[4)-beta-D-Galp-(1->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->]n 
[N-(4-cyanophenyl)-N'-(diphenylmethyl)guanidine]acetic acid  
acenaphthoquinone  
acetaldehyde +   
acetoacetyl-[acp] 
acetoacetyl-CoA  
acetyl dihydrogen phosphate 
acetyl phosphate(1-) 
acetyl-[acyl-carrier protein] 
acetylcholine +   
acryloyl-CoA  
adenine +   
adenosine 3',5'-bismonophosphate +   
adenosylcob(III)yrinic acid a,c-diamide 
adenosylcobinamide 
adenosylcobinamide guanosyl diphosphate 
adenosylcobinamide phosphate 
adenylyl selenate 
ADP alpha-D-glucoside 
ADP-D-glycero-D-manno-heptose +  
ADP-D-ribose +   
ADP-D-ribose 2'-phosphate 
ADP-L-glycero-D-manno-heptose +  
aerobactin 
agmatine +   
AICA ribonucleotide  
Ala-tRNA(Ala) 
aldehydo-D-arabinose 5-phosphate(2-) 
aldehydo-N-acyl-D-mannosamine 6-phosphate +  
aldosterone +   
alkylphosphonate 
all-cis-5,8,11,14,17-icosapentaenoic acid +  
all-cis-docosa-4,7,10,13,16,19-hexaenoic acid +   
all-cis-octadeca-6,9,12,15-tetraenoic acid +  
all-trans-4-hydroxyretinol 
all-trans-4-oxoretinal  
all-trans-hexaprenyl diphosphate 
all-trans-octaprenyl diphosphate 
all-trans-retinal +   
all-trans-retinol +   
allantoic acid 
allantoin +   
allolactose +  
alpha,alpha-trehalose +   
alpha,alpha-trehalose 6-phosphate 
alpha-(1->3)-galactobiose +  
alpha-D-Abep-(1->3)-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp 
alpha-D-fucoside 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-D-GlcNAc +  
alpha-D-Gal-(1->3)-beta-D-Gal-(1->3)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/16:0) 
alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/18:0) 
alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/20:0) 
alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/22:0) 
alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/22:1) 
alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/23:0) 
alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:0) 
alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:1(15Z)) 
alpha-D-galactosaminyl-(1->3)-[alpha-L-fucosyl-(1->2)]-beta-D-galactosyl derivative(1+) 
alpha-D-galactose +   
alpha-D-galactose 1-phosphate  
alpha-D-galactosyl-(1->2)-alpha-D-galactose 
alpha-D-galactosyl-(1->2)-beta-D-galactose +  
alpha-D-galactosyl-(1->2)-D-galactose +  
alpha-D-galactosyl-(1->2)-D-galactosyl group 
alpha-D-galactosyl-(1->3)-1D-myo-inositol 
alpha-D-galactosyl-(1->3)-D-galactose +  
alpha-D-galactosyl-(1->3)-D-galactosyl group 
alpha-D-galactosyl-(1->4)-beta-D-galactosyl group +  
alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide +   
alpha-D-galactosyl-(1->4)-beta-D-galactosyl-N-(pentacosanoyl)sphingosine 
alpha-D-GalNAc-(1->2)-beta-D-Man-(1->4)-[beta-D-Glc-(1->2)]-alpha-D-Man-(1->5)-alpha-Kdo 
alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1->1')-Cer 
alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1->1')-Cer 
alpha-D-GalNpAc-(1->3)-beta-D-GalpNAc 
alpha-D-Galp-(1->2)-[alpha-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp 
alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-D-Galp-(1->2)-[alpha-D-Tyvp-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-D-Tyvp-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-D-Galp-(1->3)-[alpha-D-Galp-(1->4)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1->1')-Cer 
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1->1')-Cer 
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group 
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group +  
alpha-D-Galp-(1->3)-beta-D-Manp 
alpha-D-Galp-(1->4)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-D-Galp-(1->4)-beta-D-GalpNAc-(1->3)-D-Galp 
alpha-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GalpN-(1->4)-alpha-D-GalpA-yl group 
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-yl group +  
alpha-D-GalpNAc-(1->3)-beta-D-Galp +  
alpha-D-GalpNAc-(1->4)-[alpha-D-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcNAc-(1->4)-beta-D-GlcA-(1->4)-alpha-D-GlcNAc-(1->4)-beta-D-GlcA-(1->3)-beta-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-Xyl-(1->3)-L-Ser 
alpha-D-GlcNAc6S-(1->4)-D-GlcA 
alpha-D-Glcp-(1->3)-alpha-L-Rhap 
alpha-D-Glcp-(1->6)-alpha-D-Glcp-(1->6)-beta-D-Glcp +  
alpha-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->3)-D-GalpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-glucosamine 1-phosphate +  
alpha-D-glucose +   
alpha-D-glucose 1,6-bisphosphate 
alpha-D-glucose 1,6-bisphosphate(4-) 
alpha-D-glucose 6-phosphate 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc-4P-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo 
alpha-D-Kdo-(2->8)-[alpha-D-Kdo-(2->4)]-alpha-D-Kdo-(2->4)-alpha-D-Kdo 
alpha-D-Kdo-(2->8)-[alpha-D-Kdo-(2->4)]-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcN-4P-(1->6)-alpha-D-GlcN-1P 
alpha-D-Kdo-(2->8)-[alpha-D-Kdo-(2->4)]-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc4P-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc-4P-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc 
alpha-D-Man-(1->2)-alpha-D-Man-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->3)-[alpha-D-Man-(1->2)-alpha-D-Man-(1->6)]-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Man-(1->3)-[alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-2-alpha-D-GlcNAc(PP-Dol) 
alpha-D-mannose +  
alpha-D-mannose 6-phosphate +  
alpha-D-mannosyl-beta-D-mannosyldiacetylchitobiosyldiphosphodolichol 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-D-Manp +  
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-alpha-D-Manp 
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-beta-D-Manp 
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc +  
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-D-Manp-(1->6)-beta-D-Manp +  
alpha-D-Manp6P-(1->3)-alpha-D-Manp-(1->3)-alpha-D-Manp-(1->3)-alpha-D-Manp-(1->2)-D-Manp +  
alpha-D-Rhap-(1->2)-alpha-D-Rhap-(1->3)-alpha-D-Rhap 
alpha-D-Rhap-(1->3)-alpha-D-Rhap 
alpha-D-Rhap-(1->3)-alpha-D-Rhap-(1->2)-alpha-D-Rhap 
alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo 
alpha-D-Rhap4NFo-(1->3)-alpha-D-Rhap4NFo +  
alpha-D-ribose 1-phosphate +  
alpha-Fuc-(1->2)-[alpha-Fuc-(1->2)-beta-Gal-(1->3)-alpha-GalNAc-(1->3)]-beta-Gal-(1->4)-beta-GlcNAc-(1->3)-beta-Gal-(1->4)-beta-Glc-(1<->1')-Cer 
alpha-GalNAc-(1->3)-[alpha-Fuc-(1->2)]-beta-Gal-(1->3)-alpha-GalNAc-(1->3)-[alpha-Fuc-(1->2)]-beta-Gal-(1->4)-beta-GlcNAc-(1->3)-beta-Gal-(1->4)-beta-Glc-(1->1')-Cer 
alpha-KDN-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-D-Glcp 
alpha-KDN-(2->6)-beta-D-Galp-(1->4)-D-GlcpNAc 
alpha-Kdo-(2->8)-[alpha-Kdo-(2->4)]-alpha-Kdo 
alpha-L-Araf-(1->2)-beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp 
alpha-L-Fuc-(1->2)-[alpha-D-Gal-(1->3)]-beta-D-Gal +  
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->3)-alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1->1')-Cer +  
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1->1')-Cer 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-D-GlcNAc 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]GlcNAc-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1->1')-Cer 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->6)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1->1')-Cer +  
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1->1')-Cer +  
alpha-L-Fuc-(1->3)-[beta-D-Gal-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-L-Fuc-(1->3)-[beta-D-Gal-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-L-Fuc-(1->3)-beta-D-GalNAc-(1->4)-beta-D-GlcNAc-yl group 
alpha-L-fucose +  
alpha-L-fucoside +  
alpha-L-fucosyl group +  
alpha-L-fucosyl-(1->2)-beta-D-galactosyl group 
alpha-L-fucosyl-(1->4)-N-acetyl-beta-D-glucosamine +  
alpha-L-Fucp-(1->2)-(1->3)-[alpha-D-Galp]-beta-D-Galp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-alpha-D-GalpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-beta-D-Galp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-beta-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-alpha-D-GalpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-Galp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[beta-D-Galp-(1->3)-alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-D-Glcp 
alpha-L-Fucp-(1->2)-[beta-D-Galp-(1->3)-alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-\{alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-(1->6)\}-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-Glcp6S +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-GlcpNAc6S +  
alpha-L-Fucp-(1->2)-beta-D-Galp6S-(1->4)-D-Glcp +  
alpha-L-Fucp-(1->2)-beta-D-Galp6S-(1->4)-D-Glcp6S +  
alpha-L-Fucp-(1->2)-beta-D-Galp6S-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-[alpha-Neup5Ac-(2->3)-beta-D-Galp6S-(1->4)]-beta-D-GlcpNAc 
alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->4)-[beta-D-Galp3S-(1->3)]-beta-D-GlcpNAc 
alpha-L-FucpNAc-(1->3)-D-FucpNAc 
alpha-L-rhamnopyranose +   
alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->2)-alpha-L-Rhap 
alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->3)-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-L-Rhap 
alpha-L-Rhap-(1->3)-alpha-D-Galp 
alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-L-Rhap-(1->3)-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc 
alpha-linolenic acid +   
alpha-linolenoyl-CoA 
alpha-maltose 6'-phosphate 
alpha-Man-(1->2)-alpha-Man-(1->2)-alpha-Man-(1->3)-[alpha-Man-(1->2)-alpha-Man-(1->3)-alpha-Man-(1->6)]-beta-Man-(1->4)-beta-GlcNAc-(1->4)-alpha-GlcNAc(PP-Dol) 
alpha-Man-(1->2)-alpha-Man-(1->2)-alpha-Man-(1->3)-[alpha-Man-(1->6)-[alpha-Man-(1->2)-alpha-Man-(1->3)]-alpha-Man-(1->6)]-beta-Man-(1->4)-beta-GlcNAc-(1->4)-alpha-GlcNAc(PP-Dol) 
alpha-mycolic acid 
alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-N-acylsphingosine +   
alpha-N-acetylneuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl group 
alpha-N-acetylneuraminyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-ceramide +  
alpha-N-acetylneuraminyl-(2->3)-D-galactosyl group +  
alpha-N-acetylneuraminyl-(2->6)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
alpha-Neu5Ac-(2->3)-beta-D-Gal (1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-Neu5Ac-(2->3)-beta-D-Gal(1->3)beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-Gal-(1->4)-beta-Glc-(1->1')-Cer(d18:1/18:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->6)]-D-GalNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->6)]-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->6)]-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->6)]-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/20:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/22:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/22:1) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/23:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:1(15Z)) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:2) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/18:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/22:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/16:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/18:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/20:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/21:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/22:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/22:1(13Z)) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/23:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:1(15Z)) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:2) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-yl group +  
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-Neu5Ac-(2->6)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-Neu5Ac-(2->3)-D-Gal +  
alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-Gal-(1->4)-beta-Glc-(1<->1')-Cer 
alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-beta-Gal-(1->4)-beta-Glc-(1<->1')-Cer 
alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-D-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
alpha-Neu5NAc-(2->8)-alpha-Neu5NAc-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-Neu9,NAc2-(2->6)-GalNAc 
alpha-NeuNAc-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-NeuNAc-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
alpha-Neup5,9Ac2-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5,9Ac2-(2->6)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GalpNAc 
alpha-Neup5Ac-(2->3)-alpha-D-GalpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-D-GalpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-GlcpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-D-Galp-yl group 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[beta-D-Galp-(1->4)-beta-D-Glcp-(1->6)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1->6)]-2,5-anhydro-D-Man 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-D-GalpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp6S-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)]-alpha-D-GalpNAc 
alpha-Neup5Ac-(2->6)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)]-D-GalpNAc +  
alpha-Neup5Ac-(2->6)-beta-D-Galp 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-GalpNAc 
alpha-Neup5Ac-(2->6)-beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac +  
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +   
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-[beta-D-GalpNAc-(1->4)]-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-yl group 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-beta-Neup5Ac 
alpha-Neup5Ac-(2->8)-beta-Neup5Ac 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-D-Glcp-yl group 
alpha-Neup5Gc-(2->6)-alpha-D-GalpNAc 
alpha-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-D-Glcp-yl group 
alpha-Neup5NAc-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1<->1')-Cer 
alpha-NeupNAc-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S 
alpha-ribazole +  
alpha-ribazole 5'-phosphate 
aminoacetone  
aminopropylcadaverine 
ammonia +   
ammonium +   
amylose +   
androst-4-ene-3,17-dione +   
androst-5-ene-3beta,17beta-diol  
androsterone +   
androsterone 3-glucosiduronic acid  
androsterone sulfate 
anserine 
anthranilate +  
anthranilic acid +   
apo-[acyl-carrier protein] 
apoprotein +  
arachidonic acid +   
arbutin 6-phosphate 
Arg-tRNA(Arg) 
argpyrimidine 
arsenic acid  
artemoin A 
artemoin B 
artemoin C 
artemoin D 
Asn-tRNA(Asn) 
Asp-tRNA(Asn) 
Asp-tRNA(Asp) 
Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 
asparagoside F 
aspirin-triggered resolvin D4 
benzene-1,2,4-triol  
benzo[a]pyrene +   
benzoyl-CoA +  
benzoylacetyl-CoA 
benzyl cinnamate  
benzylpenamaldate group 
benzylpenamidyl group 
benzylpenicanyl group 
benzylpenicillenyl group 
benzylpenicillin +   
benzylpenicilloic acid 
benzylpenicilloyl group +  
benzylpenilloic acid 
beryllium atom +   
beta-(1->3)-galactobiose +  
beta-carotene +   
beta-cellobiose +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)]-alpha-D-Araf-(1->5)-alpha-D-Araf +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)-alpha-D-Araf-(1->5)-alpha-D-Araf-OMe 
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)]-alpha-D-Araf-(1->5)-alpha-D-Araf-OMe +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)]-alpha-D-Araf-(1->5)-alpha-D-Araf-yl group +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-alpha-D-Araf-(1->5)-alpha-D-Araf 
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-alpha-D-Araf-(1->5)-alpha-D-Araf-OMe 
beta-D-fructofuranose +   
beta-D-fructofuranose 1,6-bisphosphate  
beta-D-fructofuranose 2,6-bisphosphate  
beta-D-fructofuranose 6-phosphate 
beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->3)-\{beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-[alpha-L-Fuc-(1->6)]-beta-D-GlcNAc 
beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->3)-\{beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
beta-D-Gal-(1->3)-[beta-D-GlcNAc-(1->6)]-D-GalNAc +  
beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/16:0) 
beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:0) 
beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:1(15Z)) 
beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +   
beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-yl group +  
beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
beta-D-Gal-(1->4)-alpha-D-Glc-(1->3)-[alpha-D-GlcNAc-(1->2)]-alpha-L-Hep 
beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-[beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->4)]-alpha-D-Man-(1->3)-[beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-D-GlcNAc +  
beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->6)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->6)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[beta-D-GlcNAc-(1->6)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
beta-D-galactose +   
beta-D-galactosyl-(1->3)-alpha-D-mannose 
beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl group 
beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl group 
beta-D-galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl group 
beta-D-galactosyl-(1->4)-beta-D-galactosyl-N-(pentacosanoyl)sphingosine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-N-hexadecanoylsphinganine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-[(15Z)-tetracosenoyl]sphingosine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-[(17Z)-hexacosenoyl]sphingosine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-acylsphingosine +  
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-docosanoylsphingosine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-eicosanoylsphingosine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-hexadecanoylsphingosine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-octadecanoylsphingosine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-tetracosanoylsphingosine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-tricosanoylsphingosine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-N-(hexacosanoyl)sphingosine 
beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl group +  
beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide +  
beta-D-galactosyl-(1<->1')-N-[(15Z)-tetracosenoyl]sphinganine 
beta-D-galactosyl-(1<->1')-N-[(17Z)-hexacosenoyl]sphinganine 
beta-D-galactosyl-(1<->1')-N-docosanoylsphinganine 
beta-D-galactosyl-(1<->1')-N-eicosanoylsphinganine 
beta-D-galactosyl-(1<->1')-N-hexacosanoylsphinganine 
beta-D-galactosyl-(1<->1')-N-hexadecanoylsphinganine 
beta-D-galactosyl-(1<->1')-N-octadecanoylsphinganine 
beta-D-galactosyl-(1<->1')-N-tetracosanoylsphinganine 
beta-D-galactosyl-1,3-(N-acetyl-beta-D-glucosaminyl-1,6)-N-acetyl-D-galactosaminyl group 
beta-D-galactosyl-N-(hexacosanoyl)sphingosine 
beta-D-galactosyl-N-(tetracosanoyl)sphingosine 
beta-D-galactosyl-N-(tricosanoyl)sphingosine 
beta-D-galactosyl-N-[(15Z)-tetracosenoyl]sphingosine 
beta-D-galactosyl-N-[(17Z)-hexacosenoyl]sphingosine 
beta-D-galactosyl-N-eicosanoylsphingosine 
beta-D-galactosyl-N-octadecanoylsphingosine 
beta-D-Galf-(1->3)-alpha-D-Manp 
beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-GalNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-D-Glc +  
beta-D-GalNAc-(1->4)-[alpha-Neu5Gc-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-yl group +  
beta-D-GalNAc-(1->4)-beta-D-GalNAc-yl group 
beta-D-Galp-(1->2)-beta-D-Galp +  
beta-D-Galp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->3)-L-glycero-alpha-D-manno-Hepp-(1->5)-Kdo 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-yl group 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcpNAc +  
beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-D-GalpNAc +  
beta-D-Galp-(1->3)-[beta-Neup5Ac-(2->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->3)-\{alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcNAc-(1->6)\}-D-GalNAc +  
beta-D-Galp-(1->3)-beta-D-Galp-(1->3)-beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp 
beta-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp 
beta-D-Galp-(1->3)-beta-D-GalpNAc +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp-(1<->1')-Cer +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-D-Glcp +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-yl group +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-D-Galp-yl group 
beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp +  
beta-D-Galp-(1->3)-D-GalpNAc +  
beta-D-Galp-(1->3)-D-GlcpNAc +  
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->6)-[beta-D-Galp-(1->3)]-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-D-Glcp +  
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-Glcp6S +  
beta-D-Galp-(1->4)-alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-alpha-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcNAcp-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->4)-beta-D-Glcp6S 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-\{alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc +  
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-[alpha-D-Manp-(1->3)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-D-GalpNAc +  
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)-alpha-D-GalpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc6S-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S-(1->3)-D-Galp 
beta-D-Galp-(1->4)-beta-D-GlcpNAc6S-(1->3)-D-Galp 
beta-D-Galp3S-(1->3-)-alpha-D-GalpNAc 
beta-D-Galp3S-(1->3-)-beta-D-GlcpNAc 
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-Glcp +  
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-Glcp6S 
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc6S +  
beta-D-Galp3S-(1->4)-beta-D-Glcp 
beta-D-Galp3S-(1->4)-beta-D-Glcp6S 
beta-D-Galp3S-(1->4)-beta-D-GlcpNAc 
beta-D-Galp3S-(1->4)-beta-D-GlcpNAc6S 
beta-D-Galp4S-(1->4)-beta-D-GlcpNAc 
beta-D-Galp6P-(1->4)-alpha-D-Manp 
beta-D-Galp6S-(1->4)-beta-D-Glcp 
beta-D-Galp6S-(1->4)-beta-D-Glcp6S 
beta-D-Galp6S-(1->4)-beta-D-GlcpNAc 
beta-D-Galp6S-(1->4)-beta-D-GlcpNAc6S 
beta-D-Galp6S-(1->4)-beta-D-GlcpNAc6S-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S-(1->3)-D-Galp 
beta-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp 
beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->3)-alpha-D-GalpNAc 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-D-Galp 
beta-D-GalpNAc-(1->4)-[alpha-Neup5Gc-(2->3)]-beta-D-Galp +  
beta-D-GalpNAc-(1->4)-[alpha-Neup5Gc-(2->3)]-beta-D-Galp-(1->4)-R group +  
beta-D-GalpNAc-(1->4)-alpha-D-GalpNAc 
beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
beta-D-GalpNAc-(1->4)-D-GlcpNAc +  
beta-D-GalpNAc4S-(1->4)-beta-D-GlcpA-(1->3)-beta-D-GalpNAc4S 
beta-D-GlcA-(1->4)-alpha-D-GlcNAc6S-(1->4)-D-GlcA 
beta-D-GlcNAc-(1->4)-MDP-Lys(L18) 
beta-D-Glcp(1->6)-alpha-D-GlcpNAc-(1->3)-alpha-L-QuipNAc-(1->3)-beta-D-GlcpNAc 
beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-GlcpO[CH2]5CO2Me 
beta-D-Glcp-(1->6)-beta-D-Glcp +  
beta-D-GlcpA-(1->3)-beta-D-Galp +  
beta-D-GlcpA-(1->3)-beta-D-GlcpNAc 
beta-D-GlcpA-(1->6)-beta-D-Galp 
beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->4)]-[beta-D-GlcpNAc-(1->6)]-D-GlcpNAc 
beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->3)-alpha-D-GalpNAc +  
beta-D-GlcpNAc-(1->3)-beta-D-Galp +  
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S-(1->3)-D-Galp 
beta-D-GlcpNAc-(1->3)-D-Manp +  
beta-D-GlcpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-GlcpNAc-(1->4)-[beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc +  
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->6)-alpha-D-GalpNAc +  
beta-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc6S-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc6S-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S-(1->3)-D-Galp 
beta-D-glucose +   
beta-D-glucose 6-phosphate 
beta-D-glucosyl-(1<->1')-N-[(15Z)-tetracosenoyl]sphinganine 
beta-D-glucosyl-(1<->1')-N-[(17Z)-hexacosenoyl]sphinganine 
beta-D-glucosyl-(1<->1')-N-docosanoylsphinganine 
beta-D-glucosyl-(1<->1')-N-eicosanoylsphinganine 
beta-D-glucosyl-(1<->1')-N-hexacosanoylsphinganine 
beta-D-glucosyl-(1<->1')-N-hexadecanoylsphinganine 
beta-D-glucosyl-(1<->1')-N-octadecanoylsphinganine 
beta-D-glucosyl-(1<->1')-N-tetracosanoylsphinganine 
beta-D-glucosyl-N-(docosanoyl)sphingosine 
beta-D-glucosyl-N-(hexacosanoyl)sphingosine 
beta-D-glucosyl-N-(octadecanoyl)sphinganine 
beta-D-glucosyl-N-(tetracosanoyl)sphingosine 
beta-D-glucosyl-N-(tricosanoyl)sphingosine 
beta-D-glucosyl-N-[(15Z)-tetracosenoyl]sphingosine 
beta-D-glucosyl-N-[(17Z)-hexacosenoyl]sphingosine 
beta-D-glucosyl-N-eicosanoylsphingosine 
beta-D-glucosyl-N-hexadecanoylsphingosine 
beta-D-glucosyl-N-octadecanoylsphingosine 
beta-D-mannose +  
beta-D-mannosyldiacetylchitobiosyldiphosphodolichol 
beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-alpha-D-Manp +  
beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-beta-D-Manp +  
beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-D-Manp +  
beta-D-QuiN4Fm-(1->4)-alpha-D-GalNAcAN-(1->4)-alpha-D-GalNAcAN-(1->3)-beta-D-QuiNAc-yl group 
beta-D-QuiN4Fm-(1->4)-alpha-D-GalNAcAN-yl group 
beta-D-Tyvp-(1->3)-beta-D-GalpN-OMe 
beta-D-Tyvp-(1->3)-beta-D-GalpN6,OMe2 
beta-D-Tyvp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-OMe 
beta-D-Tyvp-(1->3)-beta-D-GalpNAc-OMe 
beta-D-Tyvp-(1->3)-beta-D-GalpNAc6,OMe2 
beta-D-Tyvp2Me-(1->3)-beta-D-GalpN6,OMe2 
beta-D-Tyvp2Me-(1->3)-beta-D-GalpNAc-OMe 
beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->4)-beta-Glc-(1<->1')-Cer 
beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->4)-R group +  
beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->4)-beta-Glc-(1->1')-Cer 
beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->4)-beta-Glc-(1->1')-Cer(d18:1/16:0) 
beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->4)-beta-Glc-(1->1')-Cer(d18:1/18:0) 
beta-L-Ara4N-lipid A (E. coli) 
beta-L-fucosyl-(1->3)-N-acetyl-beta-D-glucosamine 
beta-L-IdopA2S-(1->3)-beta-D-GalpNAc4S-(1->4)-beta-D-GlcpA-(1->3)-beta-D-GalpNAc4S 
beta-melibiose 
beta-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-D-GlcpNAc 
beta-NeupNAc-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
betaine aldehyde 
bilirubin IXalpha  
biliverdin +   
biliverdin hydrochloride 
biocytin +  
biotin +   
biotinyl-5'-AMP 
biphenyl-2,2',3-triol 
bis(beta-glucosyluronic acid)bilirubin 
bromobenzene +   
bromohydrin pyrophosphate 
but-3-ynal 
butan-1-ol +   
butanal +   
butane-2,3-dione  
butyryl-CoA +   
C20 sphinganine +  
C20 sphingosine +  
cadaverine +   
caffeine +   
calcidiol +   
calcitriol +   
campesterol +  
canthaxanthin  
carbamic acid +   
carbamoyl phosphate 
carbon dioxide  
carbon monoxide  
carbonic acid +   
carboxyacetyl-[acyl-carrier protein] 
cardiolipin +  
carnitine +   
carnitinium +  
carnosine +   
catechol beta-D-glucuronide 
catechol beta-D-glucuronide(1-) 
CDP +   
CDP-choline  
CDP-diacylglycerol +  
CDP-ethanolamine +  
chenodeoxycholic acid +   
chenodeoxycholoyl-CoA 
chitin  
chloral hydrate  
chloramphenicol +   
chloride +   
cholate +   
cholest-5-ene 
cholesta-5,7-dien-3beta-ol +   
cholesterol +   
cholesteryl (4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate 
cholesteryl (5Z,8Z,11Z,14Z,17Z-eicosapentaenoate) 
cholesteryl (7Z,10Z,13Z,16Z,19Z)-docosapentaenoate 
cholesteryl (9Z)-heptadecenoate 
cholesteryl all-cis-icosa-8,11,14-trienoate 
cholesteryl arachidonate  
cholesteryl behenate 
cholesteryl henicosenoate 
cholesteryl heptadecanoate 
cholesteryl linoleate  
cholesteryl linolenate  
cholesteryl myristate  
cholesteryl nonadecenoate 
cholesteryl oleate  
cholesteryl palmitate  
cholesteryl palmitoleate 
cholesteryl pentadecanoate 
cholesteryl stearate  
cholesteryl tetracosadienoate 
cholic acid +   
choline +   
choline alfoscerate 
chondroitin 4'-sulfate +  
chondroitin D-glucuronate +   
chorismic acid +  
ciguatoxin ABC ring fragment 
ciguatoxin ABCDE ring fragment 
ciguatoxin JKLM ring fragment 
CII259-273 
cis,cis-2-amino-3-(3-oxoprop-1-enyl)but-2-enedioic acid 
cis-3-chloroprop-2-en-1-ol 
cis-4-hydroxy-D-proline 
cis-geranoyl-CoA 
cis-resveratrol 3-O-glucuronide 
CMP-N-acetyl-beta-neuraminic acid  
CMP-N-glycoloyl-beta-neuraminic acid 
cob(I)alamin 
cob(I)yrinic acid a,c diamide 
cob(III)alamin 
cobamamide +   
cobinamide +  
cocaine  
coenzyme A +   
cohibin C 
cohibin D 
coniferol +  
copper atom +   
coproporphyrinogen I 
coproporphyrinogen III  
corticosterone +   
cortisol +   
cortisone +   
cotinine N-oxide 
creatine +   
crosatoside B 
CTP +   
cyclodopa 5-beta-D-glucoside 
cyclohexylamine 
cyclopropylamine +  
cyromazine  
Cys-tRNA(Cys) 
cysteamine +   
cystine +   
cystine zwitterion +  
cytidine +   
cytidine 5'-monophosphate +   
cytochrome c +  
cytosine +   
D-alanine +  
D-alanyl-D-alanine 
D-alanyl-D-alanine zwitterion 
D-allose 6-phosphate 
D-alpha-D-Hepp-(1->6)-beta-D-Glcp 
D-altronic acid 
D-arabinose 5-phosphate +  
D-arginine +  
D-aspartic acid +   
D-erythro-1-(imidazol-4-yl)glycerol 3-phosphate 
D-erythrose 4-phosphate  
D-galactopyranose +   
D-galactosamine +   
D-galactosamine 6-phosphate 
D-galactosamine 6-phosphate(1-) 
D-glucitol +   
D-glucitol 6-phosphate 
D-glucono-1,5-lactone +  
D-glucopyranose +   
D-glucopyranuronate +  
D-glucosaminide +  
D-glucosyl-N-acylsphingosine +  
D-glucurono-6,3-lactone  
D-glutamic acid +  
D-glutamine +  
D-glyceraldehyde +   
D-glyceraldehyde 3-phosphate 
D-glycero-D-manno-heptose 1,7-bisphosphate +  
D-glycero-D-manno-heptose 1-phosphate 
D-glycero-D-manno-heptose 7-phosphate +  
D-mannitol +   
D-mannitol 1-phosphate 
D-mannonate 
D-methioninate 
D-methioninium 
D-ornithine +  
D-proline +  
D-ribosylnicotinic acid +  
D-ribulose +  
D-ribulose 1,5-bisphosphate 
D-ribulose 5-phosphate 
D-serine +  
D-tagatose 1,6-bisphosphate +  
D-tagaturonate 
D-tartaric acid +  
D-tyrosinate(1-) 
D-tyrosinate(2-) 
D-tyrosine +  
D-tyrosinium 
D-xylono-1,4-lactone +  
D-xylulose +   
D-xylulose 5-phosphate  
dADP +  
dATP 
dCDP 
dCTP +   
deamido-NAD(+) +   
decanoyl-[acyl-carrier protein] 
decanoyl-CoA +   
decarboxysuprofen 
decarboxytiaprofenic acid 
dehydroascorbic acid +   
dehydroepiandrosterone +   
dehydroepiandrosterone sulfate  
dehydroglycine 
Delta(9)-tetrahydrocannabinol +   
deoxyhemoglobin 
deoxyribonucleic acid +  
desmosterol +   
dethiobiotin +  
dGTP  
diacylglycerol 28:2 
diacylglycerol 40:4 +  
diethyl hydrogen phosphate 
Dig-Cy5 
digoxin +   
dihydroferulate 
dihydroferulic acid +  
dihydrofolic acid  
dihydrolipoamide +   
dihydrolipoylprotein 
dihydroxyacetone +   
dihydroxyacetone phosphate  
dimethyl sulfide +  
dimethyl sulfoxide +   
diphosphoric acid +   
disodium maleate 
dITP 
ditrans,polycis-undecaprenyl diphosphate 
Dnp-Asn-Gln 
Dnp-Gln 
Dnp-Nor-Gln 
Dnp-Sar-Gln 
Dnp-Thr-Gln 
Dnp-Trp-Gln 
dolichyl beta-D-glucosyl phosphate 
dolichyl D-mannosyl phosphate +  
dolichyl diphosphate 
dolichyl phosphate +   
dopamine +   
doxorubicin +   
dT4 
dT6 
dT8 
dTDP +   
dTDP-4-dehydro-6-deoxy-alpha-D-glucose 
dTDP-alpha-D-glucose +  
dTDP-beta-L-rhamnose 
dTDP-D-glucuronate 
dTT(6-4)TT 
dTTP +  
dUDP 
dUMP +   
dUTP +  
dyspropterin +  
E. coli strain 0111 B4 lipopolysaccharide 
ecgonine +   
ecgonine benzoate  
ecgonine methyl ester +   
egonol beta-D-glucoside 
ENPAVHFFKNIVTPRTP 
ENPVVAFFKNIVTPRTP 
ENPVVHFFFNIVTPRTP 
ENPVVHFFKNIVTPRTP 
ENPVVHFFYNIVTPRTP 
epiandrosterone sulfate 
epiandrosterone sulfate(1-) 
epimelibiose 
ergosta-5,7,24(28)-trien-3beta-ol 
estriol +   
estriol 3-O-(beta-D-glucuronide)  
estrone +   
estrone 3-O-(beta-D-glucuronide)  
estrone 3-sulfate  
ethanol +   
ethanolamine +   
ethyl dihydrogen phosphate +   
ethyl hydrogen phosphate(1-) 
ethyl phosphate(2-) 
ethylene glycol +   
FAD  
FADH2 +  
ferredoxin +  
ferrichrome  
ferricytochrome b5 
ferricytochrome c +  
ferrienterobactin(3-) 
ferrioxamine B 
ferrocytochrome b5 
ferrocytochrome c +  
ferroheme a 
flucofuron 
fluorescein-DNP hapten 
fMet-tRNA(fMet) 
FMN +   
FMNH2 +  
folic acid +   
formaldehyde +   
formyl-5-hydroxykynurenamine 
formyl-CoA 
framycetin +   
fructoselysine 6-phosphate 
fructosyllysine 
fusidic acid  
galactan +   
galactitol +  
galactitol 1-phosphate 
galactosylceramide sulfate +  
gamma-glutamyl-beta-aminopropiononitrile 
gamma-glutamyl-beta-cyanoalanine 
gamma-glutamyl-gamma-aminobutyraldehyde 
gamma-L-glutamylputrescine 
gamma-linolenic acid +   
gamma-linolenoyl-CoA 
gamma-octalactone 
GDP +   
GDP-4-dehydro-6-deoxy-alpha-D-mannose 
GDP-alpha-D-mannose +  
GDP-beta-L-fucose 
GDP-mannose +  
geranyl diphosphate  
gibberellin A20 +  
gibberellin A3 +   
gibberellin A5 
gibberellin A7 
gibberellin A9 +  
Gln-tRNA(Gln) 
Glu-tRNA(Gln) 
Glu-tRNA(Glu) 
glucuronic acid +   
glutaryl-CoA +   
glutathione +   
glutathione disulfide  
glutathionylspermidine 
glutathioselenol +  
glutaurine 
Gly-tRNA(Gly) 
glycan G00008 
glycan G10595 
glycan G10599 
glyceraldehyde 3-phosphate +   
glycerol +   
glycerol 2-phosphate  
glycogen  
glyoxal-lysine dimer 
glyoxylic acid +   
GTP +   
guaiacyl lignin +  
guanidinoacetic acid 
guanine +   
guanosine 3',5'-bis(diphosphate) 
guanosine 3'-diphosphate 5'-triphosphate 
guanosine 3'-monophosphate 
guanosine 5'-monophosphate +   
heme o +  
heparan sulfate  
heparan sulfate alpha-D-glucosaminide 
heparan sulfate alpha-D-glucosaminide 3-sulfate 
heparin glucosamine 3-O-sulfate 
heparosan N-sulfate L-iduronic acid 
heparosan-N-sulfate D-glucuronic acid 
heptan-2-one  
hexadecanal +  
hexadecasphing-4-enine +  
hexadecasphing-4-enine-1-phosphate 
hexanoyl-CoA +   
His-tRNA(His) 
histamine +   
histaminium 
HMBOA beta-D-glucoside 
holo-[acyl-carrier protein] 
homocysteine zwitterion 
homoserine lactone +   
homovanillate 
homovanillic acid +   
hordenine 
HS44 
hydantoin-5-propionate 
hydantoin-5-propionic acid 
hydrogen bromide +  
hydrogen chloride +   
hydrogen cyanide +   
hydrogen iodide +  
hydrogen peroxide +   
hydrogen sulfide +   
hydrogencarbonate +   
hydrogensulfite +   
hydroquinone +   
hydroquinone O-beta-D-glucopyranoside +   
hydroxide +  
hydroxyacetone +  
hyocholate 
hyocholic acid +  
hyodeoxycholate 
hyodeoxycholic acid +   
hypotaurine +   
Ile-tRNA(Ile) 
imidazol-4-ylacetic acid 
imidazole-4-acetaldehyde 
iminoaspartic acid 
IMP +   
indol-3-ylacetaldehyde  
indole-3-acetic acid +   
indole-5,6-quinone 
inosine +   
iron atom +   
iron(2+) +   
iron(3+) +   
iron(III) dicitrate(3-) 
iron(III) hydroxamate +   
isobutyryl-CoA +   
isomaltose +  
isopentenyl diphosphate  
isopentenyl diphosphate(3-) 
isopropyl dihydrogen phosphate 
isovaleryl-CoA 
itaconyl-CoA 
ITP +  
keto mycolic acid 
L-2-aminoadipic acid +  
L-3-oxoalanine +  
L-4-hydroxyglutamic semialdehyde 
L-adenosylselenomethionine 
L-allothreonine 
L-allysine +  
L-alpha-amino acid +   
L-arabinitol +  
L-arabinopyranose +  
L-arginine +   
L-asparagine +   
L-aspartic acid +   
L-citrulline +  
L-citrulline zwitterion +  
L-cystathionine  
L-cysteate(1-) +  
L-cysteic acid 
L-cysteinylglycine +  
L-cysteinylglycine zwitterion 
L-cystine +   
L-dehydroascorbic acid  
L-dopa +  
L-dopachrome 
L-dopaquinone 
L-fucopyranose +  
L-fuculose +  
L-galactonic acid +  
L-gamma-glutamyl phosphate +  
L-gamma-glutamyl-L-cysteine +   
L-glutamic 5-semialdehyde +  
L-glutamic acid +   
L-glutamine +   
L-glycero-alpha-D-manno-Hepp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->3)-L-glycero-alpha-D-manno-Hepp-(1->5)-alpha-Kdo 
L-gulono-1,4-lactone 
L-histidinate(1-) 
L-histidinate(2-) 
L-histidine +   
L-histidinium(1+) +  
L-histidinium(2+) 
L-histidinol +  
L-histidinol phosphate 
L-homocitrulline +  
L-homocitrulline zwitterion 
L-homocysteine +  
L-homoserine +  
L-idonate +  
L-idonic acid +  
L-idopyranose 6-monomycolate 
L-isoleucinate 
L-isoleucine +   
L-isoleucinium +  
L-kynurenine +  
L-leucinate +  
L-leucine +   
L-leucinium +  
L-lysinate 
L-lysine +   
L-lysinium(1+) +  
L-lysinium(2+) +  
L-methioninate +   
L-methionine +   
L-methionine (R)-S-oxide +  
L-methionine S-oxide +  
L-methioninium +  
L-ornithine +   
L-phenylalaninate +  
L-phenylalanine +   
L-phenylalaninium +  
L-proline +   
L-rhamnulose +  
L-rhamnulose 1-phosphate 
L-ribulose +  
L-ribulose 5-phosphate 
L-saccharopine 
L-serine +   
L-Thr-(N->6)-alpha-D-Galp6d3OAc-(1->3)-beta-D-GalpNAc 
L-threoninate 
L-threonine +  
L-threoninium +  
L-thyroxine +  
L-tryptophan +   
L-valine +   
L-xylulose +  
L-xylulose 5-phosphate 
lactaldehyde +  
lactate +  
lactose 6'-phosphate 
lanosterol +   
lauroyl-CoA +   
Leu-tRNA(Leu) 
leucomethylene blue 
leukotriene A4 +   
leukotriene B4 +   
leukotriene C3 
leukotriene C4 +   
leukotriene D3 
leukotriene D4  
linoleoyl-CoA 
lipid A (E. coli) +  
lipid II 
lipid X 
lipoamide +   
lipoprotein +  
lipoyl-AMP +  
lipoylprotein 
lithocholate +  
lithocholic acid +   
LL-2,6-diaminopimelic acid +  
Lys-GalA 
Lys-Thr-Trp-Gly-Lys-Asn-Leu-Val-Phe 
Lys-tRNA(Lys) 
maleamic acid 
maleic acid +   
malonyl-CoA  
maltohexaose 
maltose +   
maltotetraose 
manganese atom +   
mannitol +   
mannonic acid +  
marinobufagenin  
melatonin +   
melibiitol 
melibiose +   
menaquinol +  
menaquinone +   
menaquinone-9 +  
mercury(2+) 
meso-2,6-diaminopimelic acid dizwitterion 
Met-tRNA(Met) 
methacholine +   
methacrylyl-CoA  
methanesulfonic acid +   
methanol +   
methionine +   
methoxy mycolic acid 
methyl 4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-2-O-methyl-alpha-D-mannopyranoside 
methyl dihydrogen phosphate  
methyl group 
methyl nonanoate 
methyl phosphate(2-) 
methyl propenyl ketone +  
methylamine +   
methylcobalamin  
methylglyoxal +   
methylglyoxal-lysine dimer 
minocycline +   
Mo-molybdopterin cofactor +  
molybdate +   
monoacylglycerol phosphate +   
monodehydro-L-ascorbic acid 
murideoxycholate 
murideoxycholic acid 
myo-inositol +   
myo-inositol 1,3,4,5,6-pentakisphosphate 
myo-inositol 1,3,4,6-tetrakisphosphate 
myo-inositol hexakisphosphate  
myristoyl-[acyl-carrier protein] 
myristoyl-CoA +   
N(1)-(5-phospho-D-ribosyl)glycinamide 
N(1)-acetylspermidine 
N(2)-(5'-phosphopyridoxyl)-L-lysine 
N(2)-acetyl-L-ornithine 
N(2)-acetyl-L-ornithine zwitterion 
N(2)-succinyl-L-arginine 
N(2)-succinyl-L-glutamic acid 
N(2)-succinyl-L-ornithine 
N(4)-\{beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->3)-[alpha-D-Man-(1->6)]-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc\}-Asn residue 
N(4)-\{beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc\}-Asn residue 
N(4)-\{N-acetyl-beta-D-glucosaminyl-(1->2)-alpha-D-mannosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->2)-alpha-D-mannosyl-(1->6)]-beta-D-mannosyl-(1->4)-N-acetyl-beta-D-glucosaminyl-(1->4)-[alpha-L-fucosyl-(1->6)]-N-acetyl-beta-D-glucosaminyl\}-L-asparagine 
N(5)-[(Z)-amino(hydroxyimino)methyl]ornithine +  
N(6),N(6),N(6)-trimethyl-L-lysine +  
N(6)-acetyl-N(2)-(5'-phosphonatopyridoxyl)-L-lysinate(2-) 
N(6)-acetyl-N(2)-(5'-phosphopyridoxyl)-L-lysine 
N(6)-dansyl-L-lysine 
N(6)-Dnp-Lys-NH2 
N(8)-acetylspermidine 
N(alpha)-methyl-L-tryptophan 
N(tele)-methylhistamine  
N,N'-diacetylchitobiose +  
N,N'-diacetylchitobiosyldiphosphodolichol 
N,N-dimethylglycine  
N,N-dimethyltetradecanamide 
N,O-(Dnp)2-Tyr-Gln 
N-(11Z-icosenoyl)-sphingosine-1-phosphocholine 
N-(15Z)-tetracosenoylsphingosine 
N-(17Z-hexacosenoyl)-sphingosine-1-phosphocholine 
N-(17Z-hexacosenoyl)sphingosine 
N-(2,3-dihydroxybenzoyl)-L-serine 
N-(5'-phosphonatopyridoxyl)-D-alaninate(2-) 
N-(5'-phosphonatopyridoxyl)-L-alaninate(2-) 
N-(5'-phosphopyridoxyl)-D-alanine 
N-(5'-phosphopyridoxyl)-L-alanine 
N-(9Z-hexadecenoyl)sphingosine-1-phosphocholine 
N-(hexadecanoyl)-beta-D-galactosylsphingosine 
N-(p-nitrophenylphosphobutanoyl)glycine 
N-(trans-4'-nitro-4-stilbenyl)-N-methyl-5-aminopentanoic acid 
N-2-hydroxypalmitoylsphingosine 
N-[(11Z)-octadecenoyl]sphinganine-1-phosphocholine 
N-[(13Z)-docosenoyl]sphing-4-enine-1-phosphocholine 
N-[(13Z)-docosenoyl]sphingosine 
N-[(15Z)-tetracosenoyl]sphing-4-enine-1-phosphocholine 
N-[(15Z)-tetracosenoyl]sphinganine 
N-[(15Z)-tetracosenoyl]sphingosine 1-phosphate 
N-[(17Z)-hexacosenoyl]sphinganine 
N-[(9-beta-D-ribofuranosylpurin-6-yl)carbamoyl]threonate 
N-[(9-beta-D-ribofuranosylpurin-6-yl)carbamoyl]threonine 
N-[(9Z)-octadecenoyl]sphinganine 
N-[(R)-4-phosphopantothenoyl]-L-cysteine 
N-[(R)-pantothenoyl]-L-cysteine +  
N-[12(S)-hydroperoxy-(5Z,8Z,10E,14Z)-icosatetraenoyl]taurine 
N-[15(S)-hydroperoxy-(5Z,8Z,11Z,13E)-icosatetraenoyl]taurine 
N-[4-(4-nitrophenylphospho)butanoyl]-D-alanine 
N-[4-(4-nitrophenylphospho)butanoyl]-L-alanine 
N-\{alpha-Glc-(1->2)-alpha-Glc-(1->3)-alpha-Glc-(1->3)-alpha-Man-(1->2)-alpha-Man-(1->2)-alpha-Man-(1->3)-[alpha-Man-(1->2)-alpha-Man-(1->3)-[alpha-Man-(1->2)-alpha-Man-(1->6)]-alpha-Man-(1->6)]-beta-Man-(1->4)-beta-GlcNAc-(1->4)-beta-GlcNAc\}-L-Asn residue 
N-\{alpha-Glc-(1->3)-alpha-Glc-(1->3)-alpha-Man-(1->2)-alpha-Man-(1->2)-alpha-Man-(1->3)-[alpha-Man-(1->2)-alpha-Man-(1->3)-[alpha-Man-(1->2)-alpha-Man-(1->6)]-alpha-Man-(1->6)]-beta-Man-(1->4)-beta-GlcNAc-(1->4)-beta-GlcNAc\}-L-Asn residue 
N-\{alpha-Glc-(1->3)-alpha-Man-(1->2)-alpha-Man-(1->2)-alpha-Man-(1->3)-[alpha-Man-(1->2)-alpha-Man-(1->3)-[alpha-Man-(1->2)-alpha-Man-(1->6)]-alpha-Man-(1->6)]-beta-Man-(1->4)-beta-GlcNAc-(1->4)-beta-GlcNAc\}-L-Asn residue 
N-\{alpha-Man-(1->3)-[alpha-Man-(1->3)-[alpha-Man-(1->6)]-alpha-Man-(1->6)]-beta-Man-(1->4)-beta-GlcNAc-(1->4)-beta-GlcNac\}-L-Asn residue 
N-\{beta-D-Man-(1->2)-beta-D-Man-(1->2)-beta-D-ManO[CH2]3S[CH2]2NHC(O)[CH2O]4C(O)[CH2]2S[CH2]2C(O)\}-YGKDVKDLFDYAQE-NH-[CH2O]3[CH2]2C(O)NHC(CO2H)[CH2]4N3 +  
N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 
N-acetyl-alpha-D-galactosamine +  
N-acetyl-alpha-D-galactosamine 1-phosphate 
N-acetyl-alpha-D-galactosaminyl group +  
N-acetyl-alpha-D-galactosaminyl-(1->3)-[alpha-L-fucosyl-(1->2)]-beta-D-galactose derivative 
N-acetyl-alpha-D-galactosaminyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->3)-alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide +  
N-acetyl-alpha-D-galactosaminyl-L-serine residue 
N-acetyl-alpha-D-muramoyl-L-alanine 
N-acetyl-alpha-neuraminic acid +  
N-acetyl-alpha-neuraminosyl-(2->3)-beta-D-galactosylceramide 
N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucose +  
N-acetyl-alpha-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosamine 
N-acetyl-beta-D-galactosamine +  
N-acetyl-beta-D-galactosaminyl-(1->3)-alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide +  
N-acetyl-beta-D-galactosaminyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide +  
N-acetyl-beta-D-galactosaminyl-(1->4)-N-acetyl-beta-D-glucosaminyl group 
N-acetyl-beta-D-glucosamine +   
N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide(d18:1(4E)) +  
N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide +  
N-acetyl-beta-D-glucosaminyl-(1->3)-N-acetyl-D-galactosaminyl group +  
N-acetyl-beta-D-glucosaminyl-(1->4)-N-acetyl-beta-D-glucosamine +  
N-acetyl-beta-D-glucosaminyl-1,6-(N-acetyl-beta-D-glucosaminyl-1,3)-N-acetyl-D-galactosaminyl group 
N-acetyl-beta-neuraminic acid +   
N-acetyl-beta-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosamine 
N-acetyl-D-galactosamine +  
N-acetyl-D-glucosamine 6-phosphate +  
N-acetyl-D-glucosaminide +  
N-acetyl-D-glucosaminyl-1-diphospho-ditrans,polycis-undecaprenol +  
N-acetyl-D-glucosaminyldiphosphodolichol 
N-acetyl-L-aspartate(2-) +  
N-acetyl-L-aspartic acid +   
N-acetyl-L-gamma-glutamyl phosphate 
N-acetylgalactosamine +  
N-acetylmuramic acid 6-phosphate +  
N-acetylneuraminic acid +   
N-acetylneuraminic acid 9-phosphate 
N-acetylneuraminyl group 
N-acetylneuraminyl-(2->8)-N-acetylneuraminyl-(2->8)-N-acetylneuraminyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-N-acylsphingosine +  
N-acetylputrescine 
N-acetylserotonin  
N-acyl-D-mannosamine +  
N-acylphytosphingosine +   
N-acylsphinganine +   
N-acylsphingosine 1-phosphate +  
N-acylsphingosine 1-phosphoethanolamine +  
N-arachidonoyltaurine 
N-carbamoyl-beta-alanine 
N-carbamoylaspartic acid +  
N-cyclohexylformamide 
N-cyclopropylammelide 
N-docosanoylsphinganine +  
N-docosanoylsphingosine 
N-docosanoylsphingosine-1-phosphocholine 
N-dodecanoyltaurine 
N-eicosanoylsphinganine +  
N-formyl-L-aspartic acid 
N-formyl-L-glutamic acid 
N-formyl-L-kynurenine +  
N-glycoloyl-beta-D-glucosamine 
N-glycoloylneuraminate +  
N-heneicosanoylsphingosine-1-phosphocholine 
N-henicosanoylsphinganine-1-phosphocholine 
N-heptadecanoylsphinganine-1-phosphocholine 
N-heptadecanoylsphingosine-1-phosphocholine 
N-hexacosadienoylsphingosine-1-phosphocholine 
N-hexacosanoylsphinganine-1-phosphocholine 
N-hexacosanoylsphingosine 
N-hexacosanoylsphingosine-1-phosphocholine 
N-hexadecanoyl-O-(1-octadecanoyl-2-oleoyl-sn-glycero-3-phospho)-L-serine 
N-hexadecanoylsphinganine +  
N-hexadecanoylsphinganine-1-phosphocholine 
N-hexadecanoylsphingosine-1-phosphocholine 
N-hexadecanoyltaurine 
N-hydroxy-PhIP  
N-icosanoylsphingosine 
N-icosanoyltaurine 
N-lignoceroylsphingosine-1-phosphocholine 
N-methyl-4-pyridone-3-carboxamide +  
N-methyl-6-pyridone-3-carboxamide +   
N-methylmesoporphyrin 
N-methylputrescine 
N-methyltyramine +   
N-myristoylsphingosine-1-phosphocholine 
N-nonadecanoylsphingosine-1-phosphocholine 
N-octadecanoylsphingosine 
N-octanoylisoglobotriaosyl ceramide 
N-octodecanoylsphinganine +  
N-oleoyl-L-serine 
N-oleoylsphinganine-1-phosphocholine 
N-oleoylsphingosine 
N-oleoylsphingosine-1-phosphocholine 
N-oleoylthreonine 
N-pentadecanoylsphingosine-1-phosphocholine 
N-phosphocreatine 
N-ribosylnicotinamide  
N-stearoylsphingosine-1-phosphocholine 
N-stearoyltaurine 
N-succinyl-L-glutamic 5-semialdehyde 
N-succinyl-LL-2,6-diaminopimelic acid 
N-tetracosadienoylsphingosine-1-phosphocholine 
N-tetracosanoylsphinganine +  
N-tetracosanoylsphinganine-1-phosphocholine 
N-tetracosanoylsphingosine 
N-tetracosanoyltaurine 
N-tetradecanoyltaurine 
N-tetradecenoylsphingosine-1-phosphocholine 
N-tricosanoylsphing-4-enine-1-phosphocholine 
N-tricosanoylsphinganine-1-phosphocholine 
N-tricosanoylsphingosine 
N-tricosenoylsphing-4-enine-1-phosphocholine 
N-tridecanoylsphingosine-1-phosphocholine 
NAD(+)  
naphthalene +   
naphthalene-1,2-diol +   
nickel atom +   
nicotinamide +   
nicotinic acid +   
nicotinic acid D-ribonucleotide +  
nitric oxide  
NMN zwitterion  
novobiocin  
nucleoside diphosphate +   
nucleoside triphosphate +   
O(4)-phospho-L-tyrosine +  
O,O-diethyl hydrogen thiophosphate 
O-(2-aminopropyl)-O'-(2-methyoxyethyl)octa(propylene glycol) 
O-[(2E)-hexenedioyl]carnitine 
O-[(3R,11Z,14Z)-3-hydroxyicosadienoyl]carnitine 
O-[(7Z,10Z,13Z,16Z,19Z)-docosapentaenoyl]carnitine 
O-[N-acetyl-alpha-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosaminyl]-L-serine residue 
O-acetyltropine 
O-hydroxy(phenyl)phosphinoyl ecgonine methyl ester 
O-methylserotonin +   
O-octadecadiendioylcarnitine 
O-octenedioylcarnitine 
O-palmitoyl-L-carnitine 
O-phospho-L-homoserine 
O-phospho-L-serine +  
O-phospho-L-threonine +  
O-phosphoethanolamine +  
O-phosphonato-L-serine(2-) +  
O-succinyl-L-homoserinate(1-) 
O-succinyl-L-homoserine 
obtusifoliol 
octanoic acid +   
octanoyl-[acyl-carrier protein] 
octanoyl-CoA +  
octulose 8-phosphate 
oleate +  
oleic acid +   
oleoyl-CoA  
oleyl acetate 
oregon green 488 
ornidazole  
ornithine +   
orotic acid +   
orotidine 5'-phosphate 
oxaluric acid 
oxalyl-CoA 
oxamic acid +   
oxidized adrenodoxin 
oxidized ferredoxin +  
oxirane +   
P(1),P(3)-bis(5'-adenosyl) triphosphate 
P(1),P(4)-bis(5'-adenosyl) tetraphosphate  
P(1),P(4)-bis(5'-guanosyl) tetraphosphate  
P(1),P(4)-bis(5'-xanthosyl) tetraphosphate 
P(1),P(4)-bis(uridin-5'-yl) tetraphosphate 
P(1),P(5)-bis(5'-adenosyl) pentaphosphate  
p-cresol +   
p-nitrobenzyl glutaryl glycinic acid 
p-nitrophenylphosphocholine 
p-tolyl beta-D-glucuronide 
p-tolyl beta-D-glucuronide(1-) 
P. aeruginosa serotype O11 O-specific polysaccharide 
palmitoleic acid +   
palmitoleyl alcohol +  
palmitoyl-[acyl-carrier protein] 
palmitoyl-CoA +   
palmityl acetate 
pantetheine 
paraoxon  
parathion  
pelargonidin 3-O-sophoroside 
perillic acid +   
perillyl aldehyde  
perillyl-coenzyme A 
Phe(4-NO2)-Gln 
Phe-tRNA(Phe) 
phenanthrene +   
phenanthrene-3,4-diol +  
phenol +   
phenolic phthiocerol +  
phenyl phosphate 
phenylacetaldehyde +   
phenylacetate +  
phenylacetic acid +   
phenylacetyl-CoA +  
phenylacetylglycine +   
phenylacetylglycine(1-) 
phosphatidic acid +   
phosphatidic acid 18:3 
phosphatidyl-N-methylethanolamine +  
phosphatidylcholine 10:0 
phosphatidylcholine 12:0 +  
phosphatidylcholine 13:0 +  
phosphatidylcholine 15:0 
phosphatidylcholine 15:1 
phosphatidylcholine 18:0 
phosphatidylcholine 18:2 
phosphatidylcholine 18:3 
phosphatidylcholine 25:0 
phosphatidylcholine O-13:0 
phosphatidylethanolamine 18:0 zwitterion 
phosphatidylethanolamine 18:1 zwitterion 
phosphatidylethanolamine 18:2 zwitterion 
phosphatidylethanolamine 20:3 zwitterion 
phosphatidylethanolamine 20:4 zwitterion 
phosphatidylethanolamine 21:0 zwitterion 
phosphatidylethanolamine 22:4 zwitterion 
phosphatidylethanolamine 35:1 +  
phosphatidylethanolamine 36:2 +  
phosphatidylethanolamine 36:3 +  
phosphatidylethanolamine 37:2 
phosphatidylethanolamine 38:3 +  
phosphatidylethanolamine 38:4 +  
phosphatidylethanolamine O-16:0 zwitterion 
phosphatidylethanolamine P-16:0 
phosphatidylglycerol +   
phosphatidylinositol 22:2(1-) 
phosphatidylserine(18:1/22:1) 
phosphocholine +   
phosphonoacetaldehyde 
phthalaldehyde  
phthiocerol A +  
phytosphingosine +   
pimelate(1-) 
pimelic acid +  
pinocarveol +  
pinocarvone 
polyprenol phosphate +   
porphobilinogen  
precorrin-2 +  
precursor Z hydrate 
pregnenolone +   
prenyl diphosphate  
A prenol phosphate that is a phosphoantigen comprising the O-pyrophosphate of prenol.
prenyl diphosphate(3-) 
prenyl phosphate 
prenyl-FMNH2 
prephenate(2-) +  
prephenic acid +  
presqualene diphosphate 
preuroporphyrinogen  
Pro-tRNA(Pro) 
procollagen 5-hydroxy-L-lysine 
progesterone +   
prop-2-ynal 
propanal +   
propane-1,2-diol +   
propanoyl phosphate 
propanoyl-AMP 
propionyl-CoA +   
prostaglandin D2 +   
prostaglandin E2 +   
prostaglandin F2alpha +   
prostaglandin G2 +   
prostaglandin H2 +   
prostaglandin I2 +   
protein disulfide +  
protein dithiol +  
protoporphyrin +   
protoporphyrinogen  
pseudotropine +  
pyridine-2,5-diol 
pyridoxal +   
pyridoxal 5'-phosphate +   
pyridoxal hydrochloride 
pyridoxamine +   
pyridoxamine 5'-phosphate 
pyridoxamine dihydrochloride 
pyridoxamine hydrochloride 
pyridoxaminium(1+) +  
pyridoxine +   
pyridoxine 5'-phosphate 
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 
queuine +  
quinolinate(1-) +  
quinolinate(2-) 
quinoline-4,6-diol 
quinoline-4,8-diol 
quinolinic acid  
raffinose +   
raphanusamic acid 
Reactive Red 6 hapten copper complex 
reduced adrenodoxin 
reduced ferredoxin +  
resolvin D5 
resolvin T1 
resolvin T2 
resolvin T3 
resolvin T4 
riboflavin +   
ribothymidine +  
rifampicin +   
S(8)-aminomethyldihydrolipoylprotein 
S(8)-glutaryldihydrolipoamide 
S-(3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl)-4'-phosphopantetheine 
S-(5-deoxy-beta-D-ribos-5-yl)-L-homocysteine 
S-(chloromethyl)glutathione 
S-(hydroxymethyl)glutathione  
S-adenosyl-4-methylthio-2-oxobutanoic acid 
S-adenosyl-L-homocysteine  
S-adenosyl-S-carboxymethyl-L-homocysteine 
S-adenosylmethioninamine 
S-butyryl-4'-phosphopantetheine 
S-choloyl-4'-phosphopantetheine 
S-decanoyl-4'-phosphopantetheine 
S-dodecanoyl-4'-phosphopantetheine 
S-formylglutathione 
S-hexadecanoyl-4'-phosphopantetheine 
S-hexanoyl-4'-phosphopantetheine 
S-methyl-5-thio-alpha-D-ribose 1-phosphate 
S-methyl-L-methionine 
S-octanoyl-4'-phosphopantetheine 
S-tetradecanoyl-4'-phosphopantetheine 
SAICAR  
sarcosine +  
secnidazole 
sedoheptulose 1,7-bisphosphate  
sedoheptulose 7-phosphate 
selane +  
selenodiglutathione 
Sem-tRNA(Met) 
Ser-tRNA(Ser) 
serotonin +   
shikimate +  
shikimic acid +   
silver(0)  
siroheme 
sirohydrochlorin +  
sitosterol +  
sn-glycerol 3-phosphate 
sodium amoxicilloyl group 
sodium glyoxylate 
sodium orotate 
somatostatin-28 
sphinga-4E,14Z-dienine +  
sphinga-4E,8E-dienine +  
sphingadienine-1-phosphate 
sphinganine +   
sphinganine 1-phosphate  
sphingosine +   
sphingosine 1-phosphate  
squalene +   
stachyose +  
starch  
stearoyl-CoA  
styrene +   
succinic semialdehyde +   
succinyl-CoA  
sucrose +   
sucrose 6(F)-phosphate 
sucrose 6(G)-phosphate 
sulcofuron 
sulcofuron-sodium 
sulfamethoxazole +   
sulfoacetic acid +  
sulfur dioxide  
sulfurothioic S-acid 
superoxide  
SW-163E 
syringal lignin 
taurine +   
taurochenodeoxycholic acid  
testosterone +   
tetracycline +   
tetradecaethylene glycol 
tetrahydrofolyl-poly(glutamic acid) macromolecule +  
theobromine  
thiamine(1+) +   
thiamine(1+) monophosphate +  
thiamine(1+) triphosphate 
thiocyanic acid +  
thioredoxin disulfide 
Thr-tRNA(Thr) 
thromboxane A2 +   
thromboxane B2 +   
thromboxane B3 
thymidine +   
thymine +   
Tnp-Gln 
trans-2-octadecenoyl-CoA 
trans-3-chloroprop-2-en-1-ol 
trans-3-methylglutaconyl-CoA 
trans-4-(dimethylphenylsilyl)-N-methylpiperidine N-oxide 
trans-4-carboxybut-2-enoyl-CoA 
trans-4-coumaric acid +  
trans-4-hydroxy-L-proline +  
trans-caffeic acid +   
trans-dec-2-enoyl-CoA 
trans-dodec-2-enoyl-CoA 
trans-hex-2-enoyl-CoA 
trans-oct-2-enoyl-CoA 
trans-tetradec-2-enoyl-CoA 
trichloroacetaldehyde +   
trichloroacetic acid +   
trichloroepoxyethane 
trichloroethene  
tridodecylamine 
trimellitic anhydride  
trimethylamine +   
trimethylamine N-oxide  
trimethylenediamine +   
tRNA(Ala) +  
tRNA(Arg) +  
tRNA(Asn) +  
tRNA(Asp) +  
tRNA(Cys) +  
tRNA(Gln) +  
tRNA(Glu) +  
tRNA(Gly) +  
tRNA(His) +  
tRNA(Ile) +  
tRNA(Leu) +  
tRNA(Lys) +  
tRNA(Met) +  
tRNA(Phe) +  
tRNA(Pro) +  
tRNA(Ser) +  
tRNA(Thr) +  
tRNA(Trp) +  
tRNA(Tyr) +  
tRNA(Val) +  
tropine +   
Trp-Gly-Ile-His-His 
Trp-tRNA(Trp) 
Trp-Tyr-Gly-Tyr-His-His 
tryptamine +   
tryptaminium 
Tyr-Met 
Tyr-tRNA(Tyr) 
tyramine +   
ubiquinol +  
ubiquinone-0 
ubiquinones +   
UDP +   
UDP-2,3-bis(3-hydroxytetradecanoyl)-D-glucosamine 
UDP-4-amino-4-deoxy-beta-L-arabinopyranose +  
UDP-4-deoxy-4-formamido-beta-L-arabinopyranose 
UDP-alpha-D-galactose  
UDP-alpha-D-galacturonic acid 
UDP-alpha-D-glucuronic acid +   
UDP-beta-L-threo-pentopyranos-4-ulose 
UDP-N-acetyl-alpha-D-glucosamine  
UDP-N-acetylmuramoyl-L-alanyl-gamma-D-glutamyl-meso-2,6-diaminopimeloyl-D-alanyl-D-alanine 
umbelliferone sulfate +   
umbelliferone sulfate(1-) 
undecaprenyldiphospho-N-acetyl-(N-acetylglucosaminyl)muramoyl-L-alanyl-D-gamma-glutamyl-meso-2,6-diaminopimeloyl-D-alanyl-D-alanine 
undecaprenyldiphospho-N-acetyl-(N-acetylglucosaminyl)muramoyl-L-alanyl-D-isoglutaminyl-L-lysyl-D-alanyl-D-alanine 
uracil +   
urea +   
uridine 5'-monophosphate +  
uroporphyrinogen I 
uroporphyrinogen III 
ursodeoxycholic acid +   
UTP +   
Val-tRNA(Val) 
vitamin K +   
vitamin K epoxide  
water +   
xanthosine 
XDP 
XTP +  
xylitol +   
zymosterol +   

Synonyms
Exact Synonyms: 3-methylbut-2-en-1-yl trihydrogen diphosphate
Related Synonyms: 2-Isopentenyl diphosphate ;   3,3-dimethylallyl pyrophosphate ;   3-methylbut-2-enyl phosphono hydrogen phosphate ;   DMAPP ;   Dimethylallyl diphosphate ;   Dimethylallyl pyrophosphate ;   Formula=C5H12O7P2 ;   InChI=1S/C5H12O7P2/c1-5(2)3-4-11-14(9,10)12-13(6,7)8/h3H,4H2,1-2H3,(H,9,10)(H2,6,7,8) ;   InChIKey=CBIDRCWHNCKSTO-UHFFFAOYSA-N ;   Monoprenyl diphosphate ;   Prenol pyrophosphate ;   SMILES=CC(C)=CCOP(O)(=O)OP(O)(O)=O ;   delta-Prenyl diphosphate ;   delta2-Isopentenyl diphosphate
Alternate IDs: CHEBI:12280 ;   CHEBI:14169 ;   CHEBI:14883 ;   CHEBI:23803 ;   CHEBI:26245 ;   CHEBI:341937 ;   CHEBI:42074 ;   CHEBI:4616 ;   CHEBI:8394
Xrefs: Beilstein:1713791 ;   CAS:358-72-5 ;   DrugBank:DB01785 ;   KEGG:C00235 ;   KEGG:C17627 ;   KNApSAcK:C00007294 ;   LIPID_MAPS_instance:LMPR01010001
Xref Mesh: MESH:C043060
Xrefs: PDBeChem:DMA ;   PMID:10608778 ;   PMID:11355861 ;   PMID:22300296 ;   PMID:23262281 ;   PMID:27356974 ;   Reaxys:1713791
Cyclic Relationships: is_conjugate_acid_of CHEBI:57623

paths to the root

NHLBI Logo

RGD is funded by grant HL64541 from the National Heart, Lung, and Blood Institute on behalf of the NIH.