Submit Data |  Help |  Video Tutorials |  News |  Publications |  FTP Download |  REST API |  Citing RGD |  Contact   

Ontology Browser

Term:
Parent Terms Term With Siblings Child Terms
allergen +   
epitope +   
hapten +   
phosphocholines +     
(+)-alpha-pinene 
(-)-trans-carveol 
(-)-ureidoglycolic acid 
(1->4)-beta-D-mannan 
(1-naphthyl)methanol 
(11Z)-icos-11-enoic acid +  
(11Z,14Z,17Z)-icosatrienoate 
(12S)-hydroperoxy-(14R,15S)-epoxy-(5Z,8Z,10E)-icosatrienoic acid 
(12S)-hydroperoxy-(14S,15R)-epoxy-(5Z,8Z,10E)-icosatrienoic acid 
(13E)-octadecenoic acid 
(13R)-S-cysteinyl-(14S)-hydroxy-(4Z,7Z,9E,11E,16Z,19Z)-docosahexaenoic acid 
(13R)-S-cysteinylglycinyl-(14S)-hydroxy-(4Z,7Z,9E,11E,16Z,19Z)-docosahexaenoic acid 
(13R)-S-glutathionyl-(14S)-hydroxy-(4Z,7Z,9E,11E,16Z,19Z)-docosahexaenoic acid 
(13S)-hydroxy-(14S,15S)-epoxy-(5Z,8Z,11Z)-icosatrienoic acid 
(15Z)-tetracosenoate +  
(17Z)-hexacosenoic acid +  
(1R,2S)-naphthalene 1,2-oxide 
(1S)-1,23,25-trihydroxy-24-oxocalciol 
(1S)-1,25-dihydroxy-24-oxocalciol 
(1S,2S,5S)-2-(4-glutaridylbenzyl)-5-phenylcyclohexan-1-ol 
(2,3-diphenylcyclopropyl)methyl phenyl sulfoxide 
(2-aminoethyl)phosphonic acid +  
(2-diazoniophenyl)arsonate +  
(2-hydroxyphenyl)acetate 
(2-hydroxyphenyl)acetic acid 
(2-naphthyl)methanol +  
(2-sulfonatophenyl)azo group 
(2-trans,6-cis)-dodeca-2,6-dienoyl-CoA 
(20R)-17alpha,20-dihydroxycholesterol 
(20R,22R)-20,22-dihydroxycholesterol 
(20S)-17,20-dihydroxypregn-4-en-3-one 
(20S)-20-hydroxypregn-4-en-3-one  
(20S)-hydroxyvitamin D3 
(20S,23)-dihydroxyvitamin D3 
(20S,23,24)-trihydroxyvitamin D3 
(20S,23,25)-trihydroxyvitamin D3 
(20S,24R)-dihydroxyvitamin D3 
(20S,24S)-dihydroxyvitamin D3 
(23S)-23,25,26-trihydroxycalciol +  
(24E)-3alpha,7alpha-dihydroxy-5beta-cholest-24-en-26-oyl-CoA 
(24R)-24,25-dihydroxycalciol 
(24R,25R)-3alpha,7alpha,24-trihydroxy-5beta-cholestan-26-oyl-CoA 
(24S)-24-hydroxycholesterol +   
(24S)-7alpha,24-dihydroxycholesterol 
(24S,25)-dihydroxycholesterol 
(24S,26)-dihydroxycholesterol 
(24Z),26-hydroxydesmosterol 
(25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl-CoA(4-) 
(25R)-7alpha,26-dihydroxycholest-4-en-3-one 
(25R)-cholest-5-ene-3beta,26-diol +   
(25S)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestanoyl-CoA 
(2E)-4-hydroxy-3-methylbut-2-en-1-yl diphosphate 
(2E)-4-hydroxy-3-methylbut-2-enyl diphosphate(3-) 
(2E,4E)-3,8,8,8-tetrachloro-7-(4-chlorophenyl)-2-hydroxy-6-oxo-octa-2,4-dienoate 
(2E,5Z,7E)-decatrienoylcarnitine 
(2R)-2-\{(1R)-1-hydroxy-15-[2-(20-methoxy-21-methylnonatriacontyl)cyclopropyl]pentadecyl\}hexacosanoic acid +  
(2R,3S)-2-methyl-3-propyloxirane 
(2S)-2-(4-\{[(1R,2S)-2-hydroxycyclopentyl]methyl\}phenyl)propanoic acid 
(2S)-2-hydroxy-2-methyl-3-oxobutanoic acid 
(2S,3R)-3-hydroxybutane-1,2,3-tricarboxylate 
(2S,3S)-3-hydroxy-2-methylbutanoyl-CoA 
(2S,3S)-3-hydroxy-2-methylbutanoyl-CoA(4-) 
(3,4-dihydroxyphenyl)acetate 
(3,4-dihydroxyphenyl)acetic acid +   
(3-sulfonatophenyl)azo group 
(3E)-2,3,4-trimethylhex-3-enal 
(3E)-2,6-dimethyloct-3-ene 
(3R)-3-isopropenyl-6-oxoheptanoyl-CoA 
(3R,5S)-1-pyrroline-3-hydroxy-5-carboxylic acid 
(3S)-3-hydroxy-3-methylglutaryl-CoA 
(3S)-3-isopropenyl-6-oxoheptanoyl-CoA 
(3S)-citramalyl-CoA(5-) 
(3S,4R)-3,4-dihydrophenanthrene-3,4-diol 
(3Z,6Z)-dodecadienoyl-CoA 
(4-diazoniophenyl)arsonate +  
(4-hydroxy-3-methoxyphenyl)acetaldehyde 
(4-hydroxy-3-nitrophenyl)acetic acid +  
(4-hydroxyphenyl)acetaldehyde 
(4-hydroxyphenyl)pyruvic acid +  
(4-sulfonatophenyl)azo group 
(4E)-7-methyldec-4-ene 
(4E,7E,10E,13E,16E)-docosapentaenoylcarnitine 
(4E,7E,10E,13E,16E,19E)-docosahexaenoylcarnitine 
(4R)-limonene 1-hydroperoxide 
(4R)-limonene 2-hydroperoxide 
(4S)-2-methylpentane-2,4-diol 
(4Z)-2,8:7,12:11,15:14,18:17,22-pentaanhydro-1,3-O-(2-carboxyethylidene)-4,5,6,9,10,13,19,20,21-nonadeoxy-L-arabino-L-allo-L-allo-docosa-4,9,20-trienitol 
(4Z)-2,8:7,12:11,15:14,18:17,22-pentaanhydro-4,5,6,9,10,13,19,20,21-nonadeoxy-L-arabino-L-allo-L-allo-docosa-4,9,20-trienitol 
(4Z,7Z,10Z,12E,14S,16Z,19Z,21R)-dihydroxydocosahexaenoic acid 
(4Z,7Z,10Z,13Z,15E,17S,19Z)-17-hydroperoxydocosahexaenoic acid 
(4Z,7Z,10Z,13Z,16Z)-docosa-4,7,10,13,16-pentaenoic acid +   
(4Z,7Z,10Z,13Z,16Z)-docosapentaenoyl-CoA 
(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate +  
(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoyl-CoA 
(4Z,7Z,10Z,14E,16Z,19Z)-13-hydroxydocosahexaenoate 
(4Z,7Z,10Z,14E,16Z,19Z)-13-hydroxydocosahexaenoic acid 
(5-hydroxyindol-3-yl)acetaldehyde  
(5-hydroxyindol-3-yl)acetate 
(5-hydroxyindol-3-yl)acetic acid  
(5-oxo-2-sulfo-2,5-dihydrofuran-2-yl)acetic acid 
(5alpha)-androst-3-en-17-one 
(5R)-5-isopropenyl-1,2-dimethylcyclohexane 1-hydroperoxide 
(5R)-5-isopropenyl-2-methylcyclohexane 1-hydroperoxide 
(5R)-5-isopropyl-2-methyl-2-cyclohexen-1-one 
(5S)-hydroperoxy-(14R,15S)-epoxy-(6E,8Z,11Z)-icosatrienoic acid 
(5Z)-tetradecenoylcarnitine 
(5Z,11Z,14Z)-8,9-dihydroxyicosatrienoic acid +  
(5Z,8Z,10E,14Z)-12-hydroxyicosatetraenoic acid +  
(5Z,8Z,11Z)-14,15-dihydroxyicosatrienoic acid +  
(5Z,8Z,11Z,13E)-15-HETE +   
(5Z,8Z,14Z)-11,12-dihydroxyicosatrienoic acid +  
(5Z,9E,12S,14Z)-8,11,12,20-tetrahydroxyicosa-5,9,14-trienoic acid 
(5Z,9E,12S,14Z)-8,11,12-trihydroxyicosa-5,9,14-trienoate 
(5Z,9E,14Z)-(8xi,11R,12S)-11,12-epoxy-8-hydroxyicosa-5,9,14-trienoate 
(6E,8Z)-5-oxooctadecadienoic acid 
(6R)-5,10-methenyltetrahydrofolate +  
(6R)-5,10-methenyltetrahydrofolic acid 
(6R)-5,10-methylenetetrahydrofolate(2-) +  
(6R)-5,10-methylenetetrahydrofolic acid +  
(6S)-5,6,7,8-tetrahydrofolate(2-) 
(6S)-5-formyltetrahydrofolate(2-) 
(6Z,9Z,12Z,15Z)-octadecatetraenoyl-CoA 
(6Z,9Z,12Z,15Z,18Z)-tetracosapentaenoyl-CoA 
(6Z,9Z,12Z,15Z,18Z,21Z)-3-hydroxytetracosahexaenoyl-CoA 
(6Z,9Z,12Z,15Z,18Z,21Z)-3-oxotetracosahexaenoyl-CoA 
(6Z,9Z,12Z,15Z,18Z,21Z)-tetracosahexaenoyl-CoA 
(7Z,10Z,13R,14E,16Z,19Z)-13-hydroxydocosapentaenoate 
(7Z,10Z,13R,14E,16Z,19Z)-13-hydroxydocosapentaenoic acid 
(7Z,10Z,13Z,16Z,19Z)-docosapentaenoate +  
(7Z,10Z,13Z,16Z,19Z)-docosapentaenoic acid +  
(8R,9S)-EET 
(8S)-hydroperoxy-(14S,15R)-epoxy-(5Z,9E,11Z)-icosatrienoic acid 
(8Z,11Z)-urushiol III 
(9E)-10-nitrooctadecenoic acid 
(9E)-9-nitrooctadecenoic acid 
(alpha-D-mannosyl)2-beta-D-mannosyl-diacetylchitobiosyldiphosphodolichol 
(alpha-D-mannosyl)3-beta-D-mannosyldiacetylchitobiosyldiphosphodolichol 
(alpha-D-mannosyl)4-beta-D-mannosyldiacetylchitobiosyldiphosphodolichol 
(alpha-D-mannosyl)5-beta-D-mannosyldiacetylchitobiosyldiphosphodolichol 
(alpha-D-mannosyl)6-beta-D-mannosyl-diacetylchitobiosyldiphosphodolichol 
(alpha-D-mannosyl)7-beta-D-mannosyl-diacetylchitobiosyldiphosphodolichol 
(E)-4-oxonon-2-en-1-ol 
(E)-4-oxonon-2-enal 
(E)-dec-3-en-2-ol 
(E)-hexadec-2-enoyl-CoA 
(E)-hexadec-2-enoyl-CoA(4-) 
(N(omega)-L-arginino)succinate(1-) 
(N(omega)-L-arginino)succinic acid  
(R)-(-)-allantoin 
(R)-1,2-distearoylphosphatidylethanolamine 
(R)-2-hydroxy-4-methylpentanoate 
(R)-3-hydroxy-2-oxo-4-phosphonooxybutanoic acid 
(R)-3-hydroxybutanoyl-CoA 
(R)-3-hydroxybutanoyl-CoA(4-) 
(R)-3-hydroxybutyrate +  
(R)-3-hydroxybutyric acid +  
(R)-3-hydroxylauric acid +  
(R)-4'-phosphonatopantothenate(3-) 
(R)-4'-phosphopantothenic acid 
(R)-5-diphosphomevalonic acid 
(R)-5-phosphomevalonic acid 
(R)-5-phosphonatomevalonate(3-) 
(R)-adrenaline +   
(R)-adrenaline(1+) 
(R)-icosanoylcarnitine 
(R)-lactaldehyde 
(R)-lactic acid +   
(R)-methylmalonyl-CoA 
(R)-methylmalonyl-CoA(5-) 
(R)-mevalonate 
(R)-noradrenaline  
(R)-noradrenaline(1+) 
(R)-oleoylcarnitine 
(R)-oleoylcarnitine hydrochloride 
(R)-propane-1,2-diol 
(R)-S-lactoylglutathionate(1-) 
(R)-S-lactoylglutathione 
(S)-(+)-4-(5-carboxypentyl)methamphetamine 
(S)-(+)-allantoin +  
(S)-1-phenylethanol 
(S)-2,3-epoxysqualene 
(S)-2-(4-nitrobenzyl)-DOTA 
(S)-2-\{4-[2-(2-hydroxyethylthio)acetamido]benzyl\}-DOTA 
(S)-2-hydroxy-3-methylbutyrate 
(S)-2-hydroxy-3-methylbutyric acid 
(S)-2-methylbutanoyl-CoA 
(S)-3'-hydroxy-N-methylcoclaurine 
(S)-3-aminoisobutyric acid 
(S)-3-hydroxybutanoyl-CoA 
(S)-3-hydroxybutanoyl-CoA(4-) 
(S)-3-hydroxydecanoyl-CoA 
(S)-3-hydroxyhexanoyl-CoA 
(S)-3-hydroxyisobutyryl-CoA 
(S)-3-hydroxylauroyl-CoA 
(S)-3-hydroxyoctanoyl-CoA 
(S)-3-hydroxypalmitoyl-CoA 
(S)-3-hydroxytetradecanoyl-CoA 
(S)-3-sulfonatolactate(2-) 
(S)-carnitinium 
(S)-dihydroorotate 
(S)-dihydroorotic acid 
(S)-lactaldehyde 
(S)-lactic acid +   
(S)-malate(2-) +  
(S)-methylmalonaldehydic acid 
(S)-methylmalonyl-CoA 
(S)-methylmalonyl-CoA(5-) 
(S)-N-methylcoclaurine 
(S)-propane-1,2-diol +  
(S,S)-trans-1-isopropyl-2,3,3,5-tetramethyl-6-succinylindane 
(Z)-but-2-ene-1,2,3-tricarboxylate 
(Z)-icos-13-enoic acid 
->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)]-beta-D-Galp-yl group 
->4)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
->8)-alpha-Neu5Ac-(2->3)-[beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)]-beta-D-Gal-(1->4)-yl group +   
1,1,3,3-tetramethylurea 
1,1-dichloro-2-(4-chloro-2,3-dihydroxyphenyl)-2-(4-chlorophenyl)ethylene 
1,1-dichloroethene  
1,2,3,4-tetrachlorobutane 
1,2,3-trilinoleoylglycerol  
1,2-bis(4-hydroxyphenyl)propan-2-ol 
1,2-bis(diphenylphosphino)ethane 
1,2-bis(octadec-9-enoyl)phosphatidic acid +   
1,2-bis-[(9Z,11Z)-octadecadienoyl]-sn-glycero-3-phosphoethanolamine 
1,2-di-(4Z,7Z,10Z,13Z,16Z,19Z-docosahexaenoyl)-sn-glycero-3-phosphoethanolamine 
1,2-di-(6Z,9Z-octadecadienoyl)-sn-glycero-3-phosphoethanolamine 
1,2-di-(7Z,10Z,13Z,16Z-docosatetraenoyl)-sn-glycerol 
1,2-di-(9E-hexadecenoyl)-sn-glycero-3-phosphocholine 
1,2-di-(9E-octadecenoyl)-sn-glycero-3-phospho-(1'-sn-glycerol) 
1,2-di-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphoethanolamine 
1,2-di-[(6Z)-octadecenoyl]-sn-glycero-3-phosphocholine 
1,2-di-[(6Z)-octadecenoyl]-sn-glycero-3-phosphoethanolamine 
1,2-di-[(9E)-octadecenoyl]-sn-glycero-3-phosphoethanolamine 
1,2-di-[(9Z)-octadecenoyl]-sn-glycero-3-phosphoethanolamine 
1,2-di-O-[1-(14)C]-palmitoyl-sn-glycero-3-phosphocholine 
1,2-di-O-myristoyl-sn-glycero-3-phosphocholine 
1,2-di-O-palmitoyl-sn-glycero-3-phosphocholine 
1,2-di-octadecadienoyl-sn-glycero-3-phosphocholine +  
1,2-di-octadecenoyl-sn-glycero-3-phosphocholine +  
1,2-di-palmitoleoyl-2-sn-glycerol 
1,2-diacyl-3-beta-D-galactosyl-sn-glycerol +  
1,2-diacyl-sn-glycero-3-phosphocholine(1+) +   
1,2-dibromoethane  
1,2-dihexadecanoyl-sn-glycero-3-phosphocholine  
1,2-dihexadecanoyl-sn-glycero-3-phosphoethanolamine 
1,2-dihexadecanoyl-sn-glycero-3-phosphoserine 
1,2-dihydronaphthalene-1,2-diol +   
1,2-dihydroxy-3,4-epoxy-1,2,3,4-tetrahydronaphthalene 
1,2-dihydroxyfluorene 
1,2-dilinoleoyl-sn-glycerol 
1,2-dimyristoleoyl-sn-glycerol 
1,2-dioctadecadienoyl-sn-glycero-3-phospho-(1'-sn-glycerol) 
1,2-dioleoyl-3-linoleoyl-sn-glycerol 
1,2-dioleoyl-sn-glycero-3-phospho-L-serine 
1,2-dioleoyl-sn-glycero-3-phospho-N,N-dimethylethanolamine 
1,2-dioleoyl-sn-glycero-3-phospho-N,N-dimethylethanolamine zwitterion 
1,2-dioleoyl-sn-glycero-3-phospho-N-methylethanolamine 
1,2-dioleoyl-sn-glycero-3-phospho-N-methylethanolamine zwitterion 
1,2-dioleoyl-sn-glycerol 
1,2-dipalmitoleoyl-sn-glycero-3-phosphocholine 
1,2-dipalmitoyl-sn-glycerol 
1,2-distearoyl-sn-glycero-3-phosphoserine 
1,2-distearoylphosphatidylethanolamine zwitterion +  
1,2-ditetradecanoyl-3-(6-sulfoquinovopyranosyl)glycerol 
1,2-palmitoyl-sn-glycero-3-phospho-(1'-sn-glycerol) 
1,3,7-trimethyluric acid  
1,3-diphenylguanidine +  
1,4-benzoquinone +   
1,4-butanediammonium 
1,4-dithiothreitol +   
1,4-phenylenediamine +   
1,5-anhydro-D-glucitol 
1,6:5,9:8,12:11,16-tetraanhydro-2,3,4,10,13,14-hexadeoxy-D-glycero-D-allo-D-gulo-heptadeca-2,13-dienitol 
1,7,8,9,10,10-hexachloro-4-methyl-4-azatricyclo[5.2.1.0(2,6)]dec-8-ene-3,5-dione 
1,7-dimethyluric acid  
1,7-dimethylxanthine  
1-((4-hydroxy-3-nitrophenyl)acetoxy)pyrrolidine-2,5-dione 
1-(1Z,11Z-octadecadienyl)-2-linoleoyl-sn-glycero-3-phosphoethanolamine 
1-(1Z,9Z-octadecadienyl)-2-(4Z,7Z,10Z,13Z,16Z,19Z-docosahexaenoyl)-sn-glycero-3-phosphoethanolamine 
1-(1Z-hexadecenyl)-2-(4Z,7Z,10Z,13Z,16Z,19Z-docosahexaenoyl)-sn-glycero-3-phosphoethanolamine 
1-(1Z-hexadecenyl)-2-(8Z,11Z,14Z-icosatrienoyl)-sn-glycero-3-phosphoethanolamine 
1-(1Z-hexadecenyl)-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphocholine 
1-(1Z-hexadecenyl)-2-(9Z-hexadecenoyl)-sn-glycero-3-phosphocholine 
1-(1Z-hexadecenyl)-2-arachidonoyl-sn-glycero-3-phosphoethanolamine 
1-(1Z-hexadecenyl)-2-linoleoyl-sn-glycero-3-phosphoethanolamine 
1-(1Z-hexadecenyl)-2-oleoyl-sn-glycero-3-phosphoethanolamine 
1-(1Z-octadecenyl)-2-(4Z,7Z,10Z,13Z,16Z-docosapentaenoyl)-sn-glycero-3-phosphoethanolamine 
1-(1Z-octadecenyl)-2-(8Z,11Z,14Z-icosatrienoyl)-sn-glycero-3-phosphoethanolamine 
1-(1Z-octadecenyl)-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphocholine 
1-(1Z-octadecenyl)-2-(9Z-octadecenoyl)-sn-glycero-3-phosphoethanolamine 
1-(1Z-octadecenyl)-2-arachidonoyl-sn-glycero-3-phosphoethanolamine 
1-(1Z-octadecenyl)-2-hexadecanoyl-sn-glycero-3-phosphocholine 
1-(1Z-octadecenyl)-2-hexadecanoyl-sn-glycero-3-phosphoethanolamine 
1-(1Z-octadecenyl)-2-linoleoyl-sn-glycero-3-phosphoethanolamine 
1-(1Z-octadecenyl)-2-linoleoyl-sn-glycero-3-phosphoethanolamine zwitterion 
1-(2,3-dihydro-1H-pyrrolizin-5-yl)-2-propen-1-one 
1-(2,6,6-trimethylcyclohex-2-en-1-yl)but-2-enone 
1-(3,6-di-O-sulfo-beta-D-galactosyl)-N-lauroylsphingosine 
1-(3-O-sulfo-beta-D-galactosyl)-N-[(15Z)-tetracos-15-enoyl]sphingosine 
1-(3-O-sulfo-beta-D-galactosyl)-N-stearoylsphingosine 
1-(4Z,7Z,10Z,13Z,16Z,19Z-docosahexaenoyl)-sn-glycero-3-phosphocholine 
1-(alk-1-enyl)-2-acyl-sn-glycero-3-phosphate(2-) +  
1-(alk-1-enyl)-sn-glycero-3-phosphoethanolamine +  
1-(beta-D-galactosyl)-N-behenoylsphingosine 
1-[(10Z,13Z,16Z)-docosatrienoyl]-2-[(9Z,12Z)-hexadecadienoyl]-sn-glycero-3-phospho-1D-myo-inositol 
1-[(10Z,13Z,16Z)-docosatrienoyl]-2-hexadecanoyl-sn-glycero-3-phospho-1D-myo-inositol 
1-[(10Z,13Z,16Z)-docosatrienoyl]-2-linoleoyl-sn-glycero-3-phospho-1D-myo-inositol 
1-[(11Z)-octadecenoyl]-2-[(4Z,7Z,10Z,13Z,16Z,19Z)]-docosahexaenoyl-sn-glycero-3-phosphocholine 
1-[(11Z,14Z)-icosadienoyl]-2-[(4Z,7Z,10Z,13Z,16Z)-docosapentaenoyl]-sn-glycero-3-phosphoethanolamine 
1-[(13Z,16Z)-docosadienoyl]-2-hexadecanoyl-sn-glycero-3-phospho-1D-myo-inositol 
1-[(13Z,16Z)-docosadienoyl]-2-linoleoyl-sn-glycero-3-phospho-1D-myo-inositol 
1-[(1Z)-octadecenyl]-2-[(5Z,8Z,11Z,14Z)-icosatetraenoyl]-sn-glycero-3-phosphocholine 
1-[(1Z,11Z)-octadecadienyl]-2-oleoyl-sn-glycero-3-phosphoethanolamine 
1-[(1Z,11Z)-octadecadienyl]-2-palmitoyl-sn-glycero-3-phosphoethanolamine 
1-[(1Z,9Z)-octadecadienyl]-sn-glycero-3-phosphocholine 
1-[(2Z)-hexadecenoyl]-2-[(9Z)-octadecenoyl]-sn-glycero-3-phosphocholine 
1-[(7Z)-hexadecenoyl]-2-[(5Z,8Z,11Z,14Z)-eicosatetraenoyl]-sn-glycero-3-phosphocholine 
1-[(8Z,11Z,14Z,17Z)-icosatetraenoyl]-2-[(11Z)-icosenoyl]-sn-glycero-3-phospho-1D-myo-inositol 
1-[(8Z,11Z,14Z,17Z)-icosatetraenoyl]-2-[(11Z)-octadecenoyl]-sn-glycero-3-phospho-1D-myo-inositol 
1-[(8Z,11Z,14Z,17Z)-icosatetraenoyl]-2-icosanoyl-sn-glycero-3-phospho-1D-myo-inositol 
1-[(8Z,11Z,14Z,17Z)-icosatetraenoyl]-2-octadecanoyl-sn-glycero-3-phospho-1D-myo-inositol 
1-[(9E)-hexadecenoyl]-sn-glycero-3-phosphocholine 
1-[(9Z)-hexadecenoyl]-2-[(11Z)-octadecenoyl]-sn-glycero-3-phosphocholine 
1-[(9Z)-hexadecenoyl]-2-[(5Z,8Z,11Z,14Z)-eicosatetraenoyl]-sn-glycero-3-phosphocholine 
1-[(9Z)-hexadecenoyl]-2-[(9Z)-octadecenoyl]-sn-glycero-3-phosphocholine 
1-[(9Z)-hexadecenoyl]-2-acetyl-sn-glycero-3-phosphocholine 
1-[(9Z)-hexadecenoyl]-sn-glycero-3-phosphocholine 
1-[(9Z)-hexadecenyl]-2-acetyl-sn-glycero-3-phosphocholine 
1-[(9Z)-octadecenoyl]-2-[(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoyl]-sn-glycero-3-phosphocholine 
1-[(9Z)-octadecenoyl]-2-[(6Z,9Z)-octadecadienoyl]-sn-glycero-3-phosphocholine 
1-[(9Z)-octadecenyl]-2-[(5Z,8Z,11Z,14Z)-eicosatetraenoyl]-sn-glycero-3-phosphocholine 
1-[(9Z)-octadecenyl]-2-hexadecanoyl-sn-glycero-3-phosphocholine 
1-[(9Z,12Z)-octadecadienoyl]-2-[(5Z,8Z,11Z,14Z)-icosatetraenoyl]-sn-glycero-3-phosphocholine 
1-\{4-[(2-hydroxyethyl)carbamoyl]benzyl\}-1-methylpiperidinium +  
1-acyl-sn-glycerol 3-phosphate +  
1-acyl-sn-glycerol 3-phosphate(2-) +  
1-acylglycerone 3-phosphate +  
1-acylglycerone 3-phosphate(2-) +  
1-alkyl-2-acetyl-sn-glycerol 
1-alkyl-2-acetyl-sn-glycerol 3-phosphate(2-) 
1-alkyl-2-acyl-sn-glycero-3-phosphoethanolamine +  
1-alkyl-2-acyl-sn-glycerol +  
1-alkyl-sn-glycerol 3-phosphate +  
1-alkyl-sn-glycerol 3-phosphate(2-) +  
1-alkylglycerone 3-phosphate +  
1-alkylglycerone 3-phosphate(2-) +  
1-arachidonoyl-sn-glycero-3-phospho-1D-myo-inositol 
1-arachidonoyl-sn-glycero-3-phosphocholine 
1-arachidonoyl-sn-glycero-3-phosphoethanolamine 
1-chloro-2,4,6-trinitrobenzene  
1-chloro-2,4-dinitrobenzene  
1-chlorobutan-2-ol 
1-docosanoyl-2-pentadecanoyl-sn-glycero-3-phosphoethanolamine 
1-docosanoyl-2-tetradecanoyl-sn-glycero-3-phosphoethanolamine 
1-docosene 
1-eicosyl-2-linolenyl-sn-glycero-3-phosphoethanolamine 
1-elaidoyl-sn-glycero-3-phosphocholine 
1-ethyl-2-propylcyclohexane 
1-fluoro-2,4-dinitrobenzene  
1-heptadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphocholine 
1-heptadecanoyl-2-[(9Z,12Z,15Z)-octadecatrienoyl]-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-(11Z-octadecenoyl)-sn-glycero-3-phosphoethanolamine 
1-hexadecanoyl-2-(4E,7E,10E,13E,16E,19E-docosahexaenoyl)-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-(4Z,7Z,10Z,13Z,16Z,19Z-docosahexaenoyl)-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-(4Z,7Z,10Z,13Z,16Z-docosapentaenoyl)-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-(5E,8E,11E,14E-eicosatetraenoyl)-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-(5Z,8Z,11Z,14Z-icosatetraenoyl)-sn-glycero-3-phospho-D-myo-inositol 
1-hexadecanoyl-2-(5Z,8Z,11Z,14Z-icosatetraenoyl)-sn-glycero-3-phosphoethanolamine 
1-hexadecanoyl-2-(7Z-octadecenoyl)-sn-glycero-3-phosphoethanolamine 
1-hexadecanoyl-2-(9,10-epoxyoctadecanoyl)-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-(9-oxononanoyl)-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phospho-(1'-sn-glycerol) 
1-hexadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphoethanolamine 
1-hexadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phosphoethanolamine 
1-hexadecanoyl-2-[(11Z)-octadec-9-enoyl]-sn-glycero-3-phospho-(1'-sn-glycerol) 
1-hexadecanoyl-2-[(5S,6E,8Z,11Z,14Z)-5-hydroxyicosatetraenoyl]-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-[(5Z,8Z,10E,12S,14Z)-12-hydroxyicosatetraenoyl]-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-[(7Z,10Z,13Z,16Z)-docosatetraenoyl]-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-[(7Z,10Z,13Z,16Z,19Z)-docosapentaenoyl]-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-[(9Z)-octadec-9-enoyl]-sn-glycero-3-phospho-(1'-sn-glycerol) 
1-hexadecanoyl-2-icosanoyl-sn-glycero-3-phosphoethanolamine 
1-hexadecanoyl-2-methyl-sn-glycero-3-phosphocholine 
1-hexadecanoyl-2-octadecanoyl-sn-glycero-3-phosphocholine 
1-hexadecanoyl-sn-glycero-3-phospho-D-myo-inositol 
1-hexadecanoyl-sn-glycero-3-phosphocholine +  
1-hexadecanoyl-sn-glycero-3-phosphoethanolamine 
1-hexadecyl-2-formyl-sn-glycero-3-phosphocholine 
1-icosanoyl-2-hexadecanoyl-sn-glycero-3-phosphocholine 
1-icosanoyl-2-tetradecanoyl-sn-glycero-3-phosphocholine 
1-icosanoyl-sn-glycero-3-phosphoethanolamine 
1-icosapentaenoyl-sn-glycero-3-phosphocholine 
1-iodo-2-methylundecane 
1-linoleoyl-sn-glycero-3-phosphocholine 
1-linoleoyl-sn-glycero-3-phosphoethanolamine 
1-linoleoyl-sn-glycero-3-phosphoethanolamine zwitterion 
1-methoxyphenanthrene 
1-methyl-2-hexadecanoyl-sn-glycero-3-phosphocholine 
1-methyl-7H-xanthine  
1-methyladenosine 
1-methylimidazole-4-acetaldehyde 
1-methylnicotinamide +   
1-methylpyrrolinium 
1-methyluric acid  
1-myristoyl-2-linoleoyl-sn-glycerol 
1-myristoyl-2-oleoyl-sn-glycerol +  
1-myristoyl-2-palmitoleoyl-sn-glycero-3-phosphocholine 
1-myristoyl-2-palmitoleoyl-sn-glycerol 
1-myristoyl-2-palmitoyl-sn-glycero-3-phosphocholine 
1-myristoyl-2-palmitoyl-sn-glycerol 
1-naphthaldehyde  
1-nitronaphthalene  
1-O-(1-O-hexadecanoyl-2-O-heptadecanoyl-sn-glycero-3-phosphono)-1D-myo-inositol 
1-O-(alpha-D-galactopyranosyl)-N-hexacosanoylsphinganine 
1-O-(alpha-D-galactopyranosyl)-N-pamitoylphytosphingosine 
1-O-(alpha-D-galactopyranosyl)-N-tetracosanyl-2-aminononane-1,3,4-triol 
1-O-(alpha-D-galactopyranuronosyl)-N-tetradecanoyldihydrosphingosine 
1-O-(alpha-D-galactosyl)-N-hexacosanoylphytosphingosine +   
1-O-(alpha-D-glucosyl)-29-keto-(3R,31R)-dotriacontanetriol 
1-O-[6-O-(3-phenylpropanoyl)-alpha-D-galactopyranosyl]-N-hexacosanoylsphinganine 
1-O-[6-O-(3-phenylpropanoyl)-alpha-D-galactosyl]-N-hexacosanoylphytosphingosine 
1-O-acyl-sn-glycero-3-phosphocholine(1+) +  
1-O-all-trans-retinoyl-beta-glucuronic acid 
1-O-dodecanoyl-2-O-pentacosanoyl-sn-glycero-3-phosphocholine 
1-O-palmitoyl-2-O-[1-(14)C]-linoleoyl-sn-glycero-3-phosphocholine 
1-octadec-9-enoylglycero-3-phosphate  
1-octadecadienyl-2-icosatetraenoyl-sn-glycero-3-phosphoethanolamine 
1-octadecanoyl-2-(4Z,7Z,10Z,13Z,16Z,19Z-docosahexaenoyl)-sn-glycero-3-phosphocholine 
1-octadecanoyl-2-(5E,8E,11E,14E-eicosatetraenoyl)-sn-glycero-3-phosphoethanolamine 
1-octadecanoyl-2-(7Z,10Z,13Z,16Z)-docosatetraenoyl-sn-glycero-3-phosphoethanolamine 
1-octadecanoyl-2-(7Z,10Z,13Z,16Z-docosatetraenoyl)-sn-glycero-3-phosphocholine 
1-octadecanoyl-2-[(10Z,12Z)-octadecadienoyl]-sn-glycero-3-phosphocholine 
1-octadecanoyl-2-[(2E,4E)-octadecadienoyl]-sn-glycero-3-phosphocholine 
1-octadecanoyl-2-[(4Z,7Z,10Z,13Z,16Z)-docosapentaenoyl]-sn-glycero-3-phosphoethanolamine 
1-octadecanoyl-2-[(6Z,9Z)-octadecadienoyl]-sn-glycero-3-phosphocholine 
1-octadecanoyl-2-[(8Z,10Z,12Z,14Z)-eicosatetraenoyl]-sn-glycero-3-phosphocholine 
1-octadecanoyl-2-[(9Z)-octadecenoyl]-sn-glycerol +   
1-octadecanoyl-2-[(9Z,11Z,13Z,15Z,17Z,19E)-docosahexaenoyl]-sn-glycero-3-phosphocholine 
1-octadecanoyl-2-[(9Z,12Z)-octadecadienoyl]-sn-glycero-3-phosphocholine 
1-octadecanoyl-2-octadecenoyl-sn-glycero-3-phosphocholine +  
1-octadecanoyl-2-pentadecanoyl-sn-glycero-3-phosphocholine 
1-octadecenoyl-2-icosatetraenoyl-sn-glycero-3-phosphoethanolamine 
1-octadecenoyl-2-octadecadienoyl-sn-glycero-3-phospho-(1'-sn-glycerol) 
1-octadecylglycero-3-phosphocholine 
1-oleoyl-2,3-di-linoleoyl-sn-glycerol 
1-oleoyl-2-(4Z,7Z,10Z,13Z,16Z,19Z-docosahexaenoyl)-sn-glycerol 
1-oleoyl-2-(7Z,10Z,13Z,16Z-docosatetraenoyl)-sn-glycerol 
1-oleoyl-2-(8Z,11Z,14Z-eicosatrienoyl)-sn-glycerol 
1-oleoyl-2-(alpha-linolenoyl)-sn-glycerol 
1-oleoyl-2-arachidonoyl-sn-glycero-3-phospho-1D-myo-inositol 
1-oleoyl-2-arachidonoyl-sn-glycero-3-phosphocholine 
1-oleoyl-2-arachidonoyl-sn-glycerol 
1-oleoyl-2-gondoyl-sn-glycerol 
1-oleoyl-2-linoleoyl-sn-glycero-3-phosphocholine 
1-oleoyl-2-linoleoyl-sn-glycerol 
1-oleoyl-2-linoleyl-sn-glycero-3-phosphoethanolamine 
1-oleoyl-sn-glycero-3-phosphoethanolamine 
1-palmitoleoyl-2-linoleoyl-sn-glycero-3-phosphocholine 
1-palmitoleoyl-2-linoleoyl-sn-glycerol 
1-palmitoleoyl-2-stearoyl-sn-glycero-3-phosphocholine 
1-palmitoleoyl-2-stearoyl-sn-glycerol 
1-palmitoyl-2,3-dioleoyl-sn-glycerol +  
1-palmitoyl-2-(11Z,14Z-eicosadienoyl)-sn-glycero-3-phosphocholine 
1-palmitoyl-2-(11Z,14Z-eicosadienoyl)-sn-glycerol 
1-palmitoyl-2-(11Z-eicosenoyl)-sn-glycero-3-phosphocholine 
1-palmitoyl-2-(7Z,10Z,13Z,16Z-docosatetraenoyl)-sn-glycero-3-phosphoethanolamine 
1-palmitoyl-2-(7Z,10Z,13Z,16Z-docosatetraenoyl)-sn-glycerol 
1-palmitoyl-2-(8Z,11Z,14Z-eicosatrienoyl)-sn-glycerol 
1-palmitoyl-2-(9Z-heptadecenoyl)-sn-glycero-3-phosphocholine 
1-palmitoyl-2-[(6Z,9Z,12Z)-octadecatrienoyl]-sn-glycero-3-phosphocholine 
1-palmitoyl-2-[(9Z,12Z,15Z)-octadecatrienoyl]-sn-glycero-3-phosphocholine 
1-palmitoyl-2-arachidonoyl-sn-glycero-3-phospho-(1'-sn-glycerol) 
1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine  
1-palmitoyl-2-linoleoyl-3-oleoyl-sn-glycerol 
1-palmitoyl-2-linoleoyl-sn-glycerol 
1-palmitoyl-2-octadecadienoyl-sn-glycero-3-phosphocholine 
1-palmitoyl-2-oleoyl-sn-glycerol +   
1-palmitoyl-2-palmitoleoyl-sn-glycero-3-phosphocholine 
1-palmitoyl-2-palmitoleoyl-sn-glycerol 
1-palmitoyl-2-stearoyl-sn-glycero-3-phosphoserine 
1-pentadecanoyl-2-[(5Z,8Z,11Z,14Z)-eicosatetraenoyl]-sn-glycero-3-phosphocholine 
1-pentadecanoyl-2-docosanoyl-sn-glycero-3-phosphoethanolamine 
1-pentadecanoyl-2-octadecanoyl-sn-glycero-3-phosphocholine 
1-pentadecyl-2-acetyl-sn-glycero-3-phosphocholine 
1-phenanthrol +  
1-phenylethanol +  
1-phenylethylamine +  
1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphate +  
1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphate(7-) +  
1-phosphatidyl-1D-myo-inositol 3,4-bisphosphate +  
1-phosphatidyl-1D-myo-inositol 3,4-bisphosphate(5-) +  
1-phosphatidyl-1D-myo-inositol 3,5-bisphosphate(5-) +  
1-phosphatidyl-1D-myo-inositol 3-phosphate +  
1-phosphatidyl-1D-myo-inositol 3-phosphate(3-) +  
1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate +  
1-phosphatidyl-1D-myo-inositol 4-phosphate +  
1-phosphatidyl-1D-myo-inositol 4-phosphate(3-) +  
1-phosphatidyl-1D-myo-inositol 5-phosphate(3-) +  
1-phosphatidyl-1D-myo-inositol(1-) +  
1-piperideine-2-carboxylate 
1-piperideine-6-carboxylate +  
1-pyrroline-2-carboxylate 
1-pyrroline-5-carboxylate +  
1-pyrrolinium +  
1-stearoyl-2-(7Z,10Z,13Z,16Z-docosatetraenoyl)-sn-glycero-3-phosphoserine 
1-stearoyl-2-(7Z,10Z,13Z,16Z-docosatetraenoyl)-sn-glycerol 
1-stearoyl-2-(8Z,11Z,14Z-icosa-8,11,14-trienoyl)-sn-glycerol 
1-stearoyl-2-(8Z,11Z,14Z-icosatrienoyl)-sn-glycero-3-phosphoserine 
1-stearoyl-2-arachidonoyl-sn-glycero-3-phospho-1D-myo-inositol 
1-stearoyl-2-arachidonoyl-sn-glycero-3-phosphocholine 
1-stearoyl-2-arachidonoyl-sn-glycero-3-phosphoethanolamine 
1-stearoyl-2-linoleoyl-sn-glycero-3-phospho-1D-myo-inositol 
1-stearoyl-2-linoleoyl-sn-glycero-3-phospho-L-serine 
1-stearoyl-2-linoleoyl-sn-glycerol  
1-stearoyl-2-oleoyl-sn-glycero-3-phosphoserine +  
1-stearoyl-sn-glycero-3-phospho-1D-myo-inositol 
1-stearoyl-sn-glycero-3-phosphocholine  
1-stearoyl-sn-glycero-3-phosphoethanolamine 
1-tetradecanoyl-2-(11Z-octadecenoyl)-sn-glycero-3-phosphocholine 
1-tetradecanoyl-2-[(9Z)-octadecenoyl]-sn-glycero-3-phosphocholine 
1-tetradecanoyl-2-docosanoyl-sn-glycero-3-phosphoethanolamine 
10-formyltetrahydrofolate(2-) 
10-formyltetrahydrofolic acid +   
10-nonadecenoate 
10-nonadecenoic acid +  
10-PAHSA 
10-PAHSA(1-) 
11(R)-HPETE 
11(S)-HETE 
11,12,15-trihydroxy-(5Z,8Z,13E)-icosatrienoic acid 
11,12-EET +  
11,14,15-trihydroxy-(5Z,8Z,12E)-icosatrienoic acid 
11-cis-retinal +  
11-cis-retinol +  
11-cis-retinyl palmitate 
11-dehydro-thromboxane B2  
11-dehydrocorticosterone  
11-deoxycorticosterone +   
11-deoxycortisol  
11-epi-prostaglandin F2alpha +  
11-epi-prostaglandin F2alpha(1-) 
11-HETE +  
11-nitro-1-undecene 
11-oxo-ETE +  
11-oxotestosterone 
11-PAHSA 
11-PAHSA(1-) 
11beta,17alpha,21-trihydroxypregnenolone 
11beta-hydroxyandrost-4-ene-3,17-dione 
11beta-hydroxyprogesterone 
12(R)-HPETE +  
12(S)-HEPE 
12(S)-HETE 
12(S)-HPETE +   
12(S)-HPETE(1-) 
12-HEPE +  
12-HETE +  
12-hydroxylauric acid +   
12-oxo-ETE 
12-PAHSA 
12-PAHSA(1-) 
12alpha-hydroxy-3-oxo-5beta-cholan-24-oic acid +  
13(S)-HODE 
13(S)-HOTrE 
13(S)-HPODE +  
13(S)-HPODE(1-) 
13,14-dihydro-15-oxolipoxin A4 
13,14-dihydro-15-oxolipoxin A4(1-) 
13,14-dihydrolipoxin A4 
13,14-dihydrolipoxin A4(1-) 
13-cis-retinal  
13-cis-retinol +  
13-hydroxy-(14R,15S)-epoxy-(5Z,8Z,11Z)-icosatrienoic acid 
13-hydroxy-alpha-tocopherol 
13-oxo-9Z,11E-ODE 
13-PAHSA 
13-PAHSA(1-) 
14,15-EET +   
14-demethyllanosterol  
15(R)-HEPE 
15(R)-HEPE(1-) 
15(S)-HETE 
15(S)-HETrE 
15(S)-HPETE +  
15(S)-HPETE(1-) 
15-dehydro-prostaglandin E1(1-) 
15-dehydroprostaglandin A1 
15-deoxy-Delta(12,14)-prostaglandin J3 
15-HEPE +  
15-ketoprostaglandin F1alpha(1-) 
15-methylhexadecasphing-4-enine-1-phosphocholine +  
15-oxo-ETE +   
16(R)-HETE 
16alpha-hydroxyandrost-4-ene-3,17-dione 
16alpha-hydroxydehydroepiandrosterone 
16alpha-hydroxyestrone +  
16alpha-hydroxypregnenolone 
17(R)-HDoHE 
17(R)-HDoHE(1-) 
17(S)-HDoHE 
17-phenyl-18,19,20-trinor-prostaglandin D2 
17-phenyl-18,19,20-trinor-prostaglandin E2 
17alpha,21-dihydroxypregnenolone 
17alpha-hydroxypregnenolone +   
17alpha-hydroxyprogesterone  
17beta-estradiol +   
17beta-estradiol 3-glucosiduronic acid  
17beta-estradiol 3-O-carboxymethyl ether 
17beta-estradiol 6-O-(carboxymethyl)oxime 
17beta-hydroxy-5alpha-androstan-3-one +   
17beta-hydroxy-5beta-estran-3-one 
18(R)-HEPE 
18(R)-HEPE(1-) 
18-hydroxycorticosterone 
18-hydroxyleukotriene B4 
19(S)-HETE  
19-hydroxyandrost-4-ene-3,17-dione 
19-hydroxyleukotriene B4 
19-hydroxytestosterone 
1alpha,23(S),25-trihydroxyvitamin D3 
1alpha,2beta,25-trihydroxy vitamin D3 
1D-myo-inositol 1,2-cyclic phosphate 
1D-myo-inositol 1,3,4,5-tetrakisphosphate 
1D-myo-inositol 1,3,4,5-tetrakisphosphate(8-) 
1D-myo-inositol 1,3,4-trisphosphate 
1D-myo-inositol 1,3,4-trisphosphate(6-) 
1D-myo-inositol 1,4,5,6-tetrakisphosphate 
1D-myo-inositol 1,4,5,6-tetrakisphosphate(8-) 
1D-myo-inositol 1,4,5-trisphosphate +   
1D-myo-inositol 1,4,5-trisphosphate(6-) 
1D-myo-inositol 1,4-bisphosphate 
1D-myo-inositol 1,4-bisphosphate(4-) 
1D-myo-inositol 1-phosphate  
1D-myo-inositol 1-phosphate(2-) 
1D-myo-inositol 3,4,5,6-tetrakisphosphate 
1D-myo-inositol 3,4,5,6-tetrakisphosphate(8-) 
1D-myo-inositol 3,4-bisphosphate 
1D-myo-inositol 3-phosphate 
1D-myo-inositol 3-phosphate(2-) 
1D-myo-inositol 4-phosphate 
1D-myo-inositol 4-phosphate(2-) 
2',3'-cyclic CMP 
2',3'-cyclic UMP(1-) 
2'-aminobiphenyl-2,3-diol 
2'-deoxyadenosine +   
2'-deoxyadenosine 5'-monophosphate(2-) +  
2'-deoxycytidine +   
2'-deoxycytosine 5'-monophosphate +   
2'-deoxycytosine 5'-monophosphate(2-) +  
2'-deoxyguanosine +   
2'-deoxyguanosine 5'-monophosphate +   
2'-deoxyguanosine 5'-monophosphate(2-) +  
2'-deoxyinosine 
2'-deoxyinosine 5'-phosphate(2-) 
2'-deoxyinosine-5'-diphosphate 
2'-deoxyinosine-5'-monophosphate 
2'-deoxyuridine +  
2,2',3-trihydroxydiphenyl ether 
2,2,2-trichloroethanol  
2,3,3-trimethylpentane 
2,3,5,8-tetramethyldecane 
2,3,5-trimethylhexane 
2,3-bisphospho-D-glyceric acid  
2,3-bisphosphoglyceric acid +   
2,3-bisphosphonato-D-glycerate(5-) 
2,3-didehydro-gibberellin A9 
2,3-dihydroxy-DDT +  
2,3-dihydroxybutanoic acid +  
2,3-diketogulonate 
2,3-dimethylphenyl isocyanate 
2,3-epoxymenatetrenone 
2,4,4-trimethylpentane-1,3-diyl bis(2-methylpropanoate) 
2,4,5-trinitrobenzenesulfonic acid 
2,4,6-trinitrobenzenesulfonic acid  
2,4,6-trinitrophenyl group +  
2,4-dimethyl-1-heptene 
2,4-dimethylhexane 
2,4-dimethylpentan-3-amine 
2,4-dinitro-1-thiocyanatobenzene 
2,4-dinitrophenol +   
2,4-dinitrophenyl group +  
2,5,5-trimethyl-1,3-thiazolidine-4-carboxylic acid 
2,5-diamino-6-ribosylamino-4(3H)pyrimidinone 5'-triphosphate 
2,5-dihydroxybenzaldehyde  
2,5-dihydroxybenzoate 
2,5-dihydroxybenzoic acid +   
2,5-dimethyl-p-phenylenediamine 
2,5-dimethylphenyl isocyanate 
2,6,10,14-tetramethylheptadecane 
2,6,10,15-tetramethylheptadecane 
2,6-di-O-(alpha-D-mannosyl)-1-O-(1,2-di-O-hexadecanoyl-sn-glycero-3-phosphono)-1D-myo-inositol 
2,6-dihydroxycyclohexane-1-carbonyl-CoA 
2,7,10-trimethyldodecane 
2,9-dideoxy-9-glutaramido-2,3-dehydo-N-acetylneuraminic acid 
2-(2-carboxyethyl)-4-methyl-5-propylfuran-3-carboxylic acid 
2-(4-methoxyphenyl)propan-2-ol 
2-(4-methyl-1-piperazinyl)ethanamine 
2-(acetylamino)naphthalene-1,5-disulfonic acid 
2-(p-nitrophenyl)-4-ethoxymethyleneoxazol-5-one 
2-(trifluoromethyl)benzoyl group 
2-[(11R)-hydroxy-(5Z,8Z,12E,14Z)-icosatetraenoyl]-sn-glycero-3-phosphocholine 
2-[(11Z,14Z)-icosadienoyl]-sn-glycero-3-phosphoethanolamine 
2-[(15R)-hydroxy-(5Z,8Z,11Z,13E)-icosatetraenoyl]-sn-glycero-3-phosphocholine 
2-[(15S)-hydroxy-(5Z,8Z,11Z,13E)-icosatetraenoyl]-sn-glycero-3-phosphocholine 
2-[(5Z,13E,15S)-11alpha,15-dihydroxy-9-oxoprosta-5,13-dien-1-oyl]-sn-glycero-3-phosphocholine 
2-[(5Z,13E,15S)-11alpha,15-dihydroxy-9-oxoprosta-5,13-dien-1-oyl]-sn-glycero-3-phosphoethanolamine 
2-[(5Z,8Z,11Z)-icosatrienoyl]-sn-glycero-3-phosphoethanolamine 
2-[(9S,11R)-epidioxy-(15S)-hydroperoxy-(5Z,13E)-prostadienoyl]-sn-glycero-3- phosphocholine 
2-[(9S,11R)-epidioxy-(15S)-hydroperoxy-(5Z,13E)-prostadienoyl]-sn-glycero-3-phosphoethanolamine 
2-[(9S,11R)-epidioxy-(15S)-hydroxy-(5Z,13E)-prostadienoyl]-sn-glycero-3- phosphocholine 
2-[(9S,11R)-epidioxy-(15S)-hydroxy-(5Z,13E)-prostadienoyl]-sn-glycero-3-phosphoethanolamine 
2-\{[(R)-\{[4-(aminomethyl)phenyl]amino\}\{[(1R)-1-phenylethyl]amino\}methyl]amino\}ethane-1,1-diol 
2-acetamido-2-deoxy-D-glucopyranose 1-phosphate +  
2-acetamido-5-oxopentanoate 
2-acetamidofluorene +   
2-acetyllactic acid +  
2-acyl-sn-glycero-3-phosphate +  
2-acyl-sn-glycero-3-phosphocholine(1+) +  
2-acyl-sn-glycero-3-phosphoethanolamine +  
2-amino-2-deoxy-D-glucopyranose +   
2-amino-3-(3-oxoprop-1-enyl)but-2-enedioic acid +  
2-amino-3-oxoadipic acid 
2-amino-3-phosphonopropanoic acid 
2-aminoacrylic acid +  
2-aminoethanesulfonate 
2-aminomuconate 6-semialdehyde(1-) 
2-aminomuconate(2-) 
2-aminomuconic 6-semialdehyde 
2-aminomuconic acid 
2-aminooctanoic acid 
2-aminooctanoic acid zwitterion 
2-ammonio-2-deoxy-D-glucopyranose +  
2-ammonio-2-deoxy-D-glucopyranose 6-phosphate(1-) +  
2-ammoniomuconate(1-) 
2-arachidonoylglycerol  
2-bromo-2-(bromomethyl)pentanedinitrile +   
2-butyl-1-octanol 
2-cis,6-trans,10-trans-geranylgeranyl diphosphate 
2-decaprenyl-5-hydroxy-6-methoxy-3-methyl-1,4-benzoquinone 
2-decaprenyl-6-methoxy-1,4-benzoquinone 
2-decaprenyl-6-methoxy-3-methyl-1,4-benzoquinone 
2-decaprenyl-6-methoxyphenol 
2-dehydro-L-gluconic acid 
2-deoxy-D-ribofuranose 
2-deoxy-D-ribofuranose 1-phosphate(2-) 
2-deoxy-D-ribonate 
2-deoxy-D-ribonic acid 
2-deoxy-D-ribose +  
2-deoxy-D-ribose 5-phosphate(2-) 
2-diazoniobenzenesulfonate +  
2-diazoniobenzoate +  
2-endo-amino-2-exo-benzoyl-3-exo-phenylnorbornane 
2-ethylhydracrylate 
2-ethylhydracrylic acid 
2-formamido-N(1)-(5-O-phosphonato-D-ribosyl)acetamidine 
2-formamido-N(1)-(5-phospho-D-ribosyl)acetamidine 
2-formylbenzoate 
2-formylbenzoic acid 
2-hexaprenyl-5-hydroxy-6-methoxy-3-methyl-1,4-benzoquinone 
2-hexaprenyl-6-methoxy-1,4-benzoquinone 
2-hexaprenyl-6-methoxy-3-methyl-1,4-benzoquinone 
2-hexaprenyl-6-methoxyphenol 
2-hydroxy-1,4-benzoquinone 
2-hydroxy-17beta-estradiol +   
2-hydroxy-3-(4-hydroxyphenyl)prop-2-enoic acid 
2-hydroxy-3-methylbutyrate 
2-hydroxy-3-methylbutyric acid +  
2-hydroxy-3-oxopropanoic acid 
2-hydroxy-4-isopropenylcyclohexane-1-carbonyl-CoA 
2-hydroxy-6-oxocyclohexane-1-carbonyl-CoA 
2-hydroxyacrylic acid 
2-hydroxybutyrate +  
2-hydroxybutyric acid +  
2-hydroxyestrone +   
2-hydroxyethyl methacrylate  
2-hydroxyglutaric acid +   
2-hydroxyhepta-2,4-dienedioic acid 
2-hydroxyhexadecanoate +  
2-hydroxyhexadecanoic acid +  
2-hydroxyoctadecanoate +  
2-hydroxyoctadecanoic acid +  
2-hydroxyphytanoyl-CoA(4-) 
2-hydroxypropylphosphonic acid +  
2-icosanoyl-sn-glycero-3-phosphoethanolamine 
2-isopropyl-5-methyl-1-heptanol 
2-isopropylaminoethylamine 
2-linoleoyl-sn-glycero-3-phosphoethanolamine 
2-methoxy-17beta-estradiol +  
2-methoxy-17beta-estradiol 3-O-(beta-D-glucuronide) 
2-methoxy-4-nitrophenyl isocyanate 
2-methoxyestrone +   
2-methoxyestrone 3-O-(beta-D-glucuronide) 
2-methyl-1,3-thiazolidine-2-carboxamide 
2-methyl-1,4-phenylenediamine  
2-methyl-1-hydroxypropylthiamine diphosphate 
2-methyl-1-pentene 
2-methyl-3-ketovaleric acid 
2-methyl-3-oxopropanoate +  
2-methylacetoacetyl-CoA 
2-methylacetoacetyl-CoA(4-) 
2-methylbutan-2-amine 
2-methylbutanoyl-CoA(4-) +  
2-methylbutyric acid +   
2-methylbutyrylcarnitine +  
2-methylcitrate(3-) +  
2-methylcrotonoyl-CoA(4-) 
2-methylerythritol 
2-methylhexenoyl-CoA 
2-methylpropane-1,2-diol 
2-methyltridecane 
2-naphthaldehyde 
2-naphthoic acid +   
2-naphthol +   
2-naphthoyl-CoA 
2-nitrobenzenediazonium +  
2-O-alpha-D-mannosyl-1-O-\{1-O-[(10S)-10-methyloctadecanoyl]-2-O-palmitoyl-sn-glycero-3-phosphonato\}-5-O-palmitoyl-6-O-(6-O-palmitoyl-alpha-D-mannosyl)-1D-myo-inositol +  
2-O-alpha-D-mannosyl-1-O-\{1-O-[(10S)-10-methyloctadecanoyl]-2-O-palmitoyl-sn-glycero-3-phosphono\}-5-O-palmitoyl-6-O-(6-O-palmitoyl-alpha-D-mannosyl)-1D-myo-inositol 
2-O-palmitoyl-2'-O-sulfo-3-O-[(2S,4S,6S,8S)-2,4,6,8-tetramethyltriacontanoyl]-alpha,alpha-trehalose 
2-O-sulfate-4-hydroxyacetophenone 
2-oxoadipate(2-) 
2-oxoadipic acid  
2-oxobutanoate 
2-oxoglutaramate +  
2-oxoglutarate(2-) 
2-oxopentanoic acid 
2-phenylacetamide 
2-phenylethanaminium 
2-phenylethyl isocyanate 
2-phenylethylamine +   
2-phospho-D-glyceric acid 
2-phosphoglycerate(3-) 
2-phosphoglycolic acid 
2-phosphonato-D-glycerate(3-) 
2-phosphonatoglycolate(3-) 
2-stearoyl-sn-glycero-3-phosphocholine 
2-tetradecanoyl-sn-glycero-3-phosphocholine 
2-thienylacetic acid +  
2-thiobarbituric acid +   
2-tolyl isocyanate 
2-trans,6-trans,10-trans-geranylgeranyl diphosphate  
2-trans,6-trans,10-trans-geranylgeranyl diphosphate(3-) 
2-trans,6-trans-farnesyl diphosphate +   
2-trans,6-trans-farnesyl diphosphate(3-) 
2-trimethylaminoethylphosphonic acid 
20(S),25-dihydroxyvitamin D3 
20-HETE +   
20-hydroxy-leukotriene B4 
20-hydroxy-leukotriene B4(1-) 
20-hydroxy-leukotriene E4(1-) 
20-hydroxycholesterol  
21-HDoHE 
21-hydroxypregnenolone +  
23(S),25-dihydroxy-24-oxovitamin D3 
23-acetoxysoladulcidine 
24,25-dihydrolanosterol +   
24-methylenecholesterol +  
24-methylidenelophenol 
24G7 epitope +   
25-hydroxycholesterol  
26-hydroxycholesterol +   
2beta-hydroxytestosterone 
3',4'-O-disulfo-N-acetyllactosamine 
3',5'-cyclic AMP +   
3',5'-cyclic AMP(1-) 
3',5'-cyclic CMP 
3',5'-cyclic dTMP 
3',5'-cyclic GMP +   
3',5'-cyclic GMP(1-) +  
3'-AMP 
3'-AMP(2-) 
3'-CMP  
3'-dephospho-CoA 
3'-dephospho-CoA(2-) 
3'-hydroxy-4'-methoxydiclofenac 
3'-hydroxydiclofenac 
3'-ketolactose 
3'-phospho-5'-adenylyl sulfate  
3'-phosphoadenylyl selenate 
3'-phosphonato-5'-adenylyl sulfate(4-) 
3'-UMP(2-) 
3,17-dioxoandrost-4-en-19-al 
3,3',5'-triiodothyronine +   
3,3',5,5'-tetraiodothyroacetic acid  
3,3',5-triiodo-L-thyronine +   
3,3',5-triiodo-L-thyronine sulfate 
3,3',5-triiodo-L-thyronine zwitterion 
3,3'-diiodo-L-thyronine +  
3,3-dimethylcystein-S-yl group 
3,4,5-trimethoxycinnamic acid 
3,4-di-O-methyl-alpha-L-rhamnose 
3,4-dichloroaniline +   
3,4-dihydro-4-[(5-methyl-2-furanyl)methylene]-2H-pyrrole 
3,4-dihydroxybutyric acid 
3,4-dihydroxyfluorene 
3,4-dihydroxymandelaldehyde 
3,4-dihydroxymandelate 
3,4-dihydroxymandelic acid  
3,4-dihydroxyphenylacetaldehyde  
3,4-dihydroxyphenylethyleneglycol  
3,4-dimethoxybenzoic acid +  
3,4-dimethoxyphenylethylamine 
3,4-dimethylphenyl isocyanate 
3,5-dibromocatechol 
3,5-diiodo-L-tyrosinate(1-) 
3,5-diiodo-L-tyrosine +  
3,5-dimethyloctane 
3,5-dinitrosalicylic acid 
3,5-dioxooctanedioic acid 
3,6-di-O-sulfo-beta-D-galactosyl-(1->4)-6-O-sulfo-N-acetyl-beta-D-glucosamine 
3,6-di-O-sulfo-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
3,7,11-trimethyldodecan-1-ol 
3,7-dimethyl-3-octanol 
3,7-dimethyluric acid 
3,7:6,10:9,14-trianhydro-2,5,11,12,13-pentadeoxy-4-O-(methoxymethyl)-L-arabino-L-allo-tetradec-12-enonic acid 
3,8-dimethylundecane 
3-(1H-indol-3-yl)propanoate 
3-(1H-indol-3-yl)propanoic acid  
3-(4-carboxybutanamido)-1-\{4-[(2-hydroxyethyl)carbamoyl]benzyl\}-1-methylpiperidinium 
3-(4-deoxy-beta-D-gluc-4-enosyluronic acid)-N-acetyl-D-glucosamine 
3-(4-hydroxyphenyl)lactate +  
3-(4-hydroxyphenyl)lactic acid +  
3-(4-hydroxyphenyl)pyruvate 
3-(4-oxo-4,5-dihydro-1H-imidazol-5-yl)propanoic acid 
3-(5-methylfurfuryl)pyrrole 
3-(imidazol-5-yl)lactic acid +  
3-(indol-3-yl)lactate 
3-(indol-3-yl)lactic acid  
3-(leucinocarbonyl)phenylazo group 
3-(methylthio)propionate 
3-[alpha-D-galactosyl-(1->6)-beta-D-galactosyl]-1,2-diacyl-sn-glycerol +  
3-\{[(5-nitrofuran-2-yl)methylidene]amino\}-1,3-oxazol-2-one 
3-\{[(9-cyano-10-methyl-9,10-dihydroacridin-9-yl)carbonyl]amino\}propanoic acid 
3-aminopiperidine-2-one 
3-carboxy-1-hydroxypropylthiamine diphosphate 
3-carboxy-4-methyl-5-propyl-2-furanpropanoate 
3-chloro-L-tyrosine 
3-cyano-L-alanine +  
3-decaprenyl-4,5-dihydroxybenzoic acid +  
3-decaprenyl-4-hydroxy-5-methoxybenzoic acid 
3-dehydro-4-methylzymosterol +  
3-dehydro-L-gulonate 
3-dehydrocarnitine +   
3-dehydrocarnitinium 
3-dehydrosphinganine +  
3-dehydrosphinganinium(1+) 
3-deoxychenodeoxycholic acid 
3-diazoniobenzenesulfonate +  
3-diazoniobenzoate +  
3-disulfanyl-L-alanine +  
3-furoic acid +  
3-hexaprenyl-4,5-dihydroxybenzoic acid 
3-hexaprenyl-4-hydroxy-5-methoxybenzoic acid 
3-hexaprenyl-4-hydroxybenzoic acid 
3-hydroxy-2-methylpropanoyl-CoA(4-) 
3-hydroxy-3-methylglutarate(1-) 
3-hydroxy-3-methylglutarate(2-) 
3-hydroxy-3-methylglutaric acid +  
3-hydroxy-3-methylhexanoic acid 
3-hydroxy-5-oxohexanoyl-CoA 
3-hydroxy-L-kynurenine 
3-hydroxy-N(6),N(6),N(6)-trimethyl-L-lysine 
3-hydroxyanthranilate 
3-hydroxyanthranilic acid 
3-hydroxybutanoyl-CoA +  
3-hydroxybutyrate +  
3-hydroxybutyric acid +   
3-hydroxydocosanoyl-CoA +  
3-hydroxyicosanoyl-CoA +  
3-hydroxyisobutyrate +  
3-hydroxyisovalerate 
3-hydroxyisovaleric acid +   
3-hydroxyisovaleryl-CoA 
3-hydroxyisovalerylcarnitine 
3-hydroxykynurenine +  
3-hydroxymandelic acid 
3-hydroxyoctadecanoyl-CoA +  
3-hydroxypimeloyl-CoA 
3-hydroxypropanoyl-CoA 
3-hydroxypropanoyl-CoA(4-) 
3-hydroxypropionate 
3-hydroxypropionic acid +   
3-hydroxypyruvate 
3-hydroxypyruvic acid  
3-hydroxytetracosanoyl-CoA 
3-hydroxytetradecanoic acid +  
3-iodo-L-tyrosine +  
3-keto-beta-D-galactose 
3-mercaptolactic acid 
3-mercaptopyruvate 
3-mercaptopyruvic acid 
3-methoxy-3-methylhexane 
3-methyl-2-oxobutanoate 
3-methyl-2-oxobutanoic acid  
3-methyl-2-oxovalerate +  
3-methyl-2-oxovaleric acid +   
3-methyladenine  
3-methylbut-2-enoyl-CoA 
3-methylbut-2-enoyl-CoA(4-) 
3-methylguanine +  
3-methylhexane 
3-methylhistidine 
3-methylhistidine zwitterion 
3-methylmalate(2-) 
3-methylmalic acid +  
3-O-\{(1R)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl\}-2,6-bis-O-\{(1S)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl\}-beta-D-Man-(1->4) -beta-D-GlcNAc-(1->4)-3-O-[(1S)-2-hydroxy-1-\{[(2S)-1-hydroxypropan-2-yl]oxy\}ethyl]-D-GlcNAc-yl group 
3-O-alpha-abequopyranosyl-alpha-D-mannopyranose 
3-O-beta-D-galactosyl-sn-glycerol 
3-O-methyl-alpha-L-rhamnose 
3-O-methyldopa 
3-O-methyldopa zwitterion 
3-O-sulfo-beta-D-galactose 
3-oxo-N-[(3S)-2-oxopyrrolidin-3-yl]dodecanamide 
3-oxoadipic acid +  
3-oxoadipyl-CoA 
3-oxochola-4,6-dien-24-oic acid 
3-oxodecanoyl-CoA 
3-oxodocosanoyl-CoA 
3-oxodotriacontanoyl-CoA 
3-oxohexacosanoyl-CoA 
3-oxohexanoyl-CoA 
3-oxoicosanoyl-CoA 
3-oxolauroyl-CoA 
3-oxooctadecanoyl-CoA 
3-oxooctanoyl-CoA 
3-oxopalmitoyl-[acyl-carrier protein] 
3-oxopalmitoyl-CoA 
3-oxopalmitoyl-CoA(4-) 
3-oxopimeloyl-CoA 
3-oxopristanoyl-CoA(4-) 
3-oxopropanoate 
3-oxotetracosanoyl-CoA 
3-oxotetradecanoyl-CoA 
3-pentadecylcatechol 
3-phenyllactic acid +  
3-phenylpropionate 
3-phenylpropionic acid +   
3-phospho-D-glyceric acid 
3-phospho-D-glyceroyl dihydrogen phosphate 
3-phosphonato-D-glycerate(3-) 
3-phosphonato-D-glyceroyl phosphate(4-) 
3-phosphonatooxypyruvate(3-) 
3-sulfino-L-alanine +  
3-sulfino-L-alanine(1-) +  
3-sulfinylpyruvic acid 
3-sulfonatopyruvate(2-) 
3-sulfopyruvic acid 
3-ureidoisobutyric acid 
3alpha,7alpha,12alpha,24-tetrahydroxy-5beta-cholestan-26-oyl-CoA +  
3alpha,7alpha,12alpha-trihydroxy-24-oxo-5beta-cholestan-26-oyl-CoA 
3alpha,7alpha,12alpha-trihydroxy-24-oxo-5beta-cholestan-26-oyl-CoA(4-) 
3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-en-26-oyl-CoA +  
3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-al +  
3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oic acid +  
3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl-CoA +  
3alpha,7alpha,12beta-trihydroxy-5beta-cholanate 
3alpha,7alpha,12beta-trihydroxy-5beta-cholanic acid 
3alpha,7alpha,24-trihydroxy-5beta-cholestan-26-oyl-CoA 
3alpha,7alpha-dihydroxy-24-oxo-5beta-cholestan-26-oyl-CoA 
3alpha,7alpha-dihydroxy-5beta-cholest-24-enoyl-CoA 
3alpha,7alpha-dihydroxy-5beta-cholestan-26-al 
3alpha,7alpha-dihydroxy-5beta-cholestan-26-oic acid +  
3alpha,7alpha-dihydroxy-5beta-cholestan-26-oyl-CoA +  
3alpha-hydroxy-5beta-androstan-17-one +   
3alpha-hydroxy-5beta-androstan-17-one 3-glucosiduronic acid 
3alpha-hydroxy-5beta-pregnan-20-one  
3beta,12alpha-dihydroxy-5beta-cholan-24-oic acid 
3beta,7alpha,12alpha-trihydroxy-5beta-cholan-24-oic acid 
3beta,7alpha-dihydroxy-5beta-cholan-24-oic acid 
3beta-hydroxy-4beta-methyl-5alpha-cholest-8-ene-4alpha-carboxylate 
3beta-hydroxy-4beta-methyl-5alpha-cholest-8-ene-4alpha-carboxylic acid 
3beta-hydroxy-5alpha-cholest-8-ene-4alpha-carboxylate 
3beta-hydroxy-5alpha-cholest-8-ene-4alpha-carboxylic acid 
3beta-hydroxy-5beta-pregnan-20-one 
3beta-hydroxyatractylon 
3beta-hydroxylanost-8-en-32-al  
4'-hydroxyacetophenone +   
4'-hydroxydiclofenac  
4,4'-(ethyl-2-nitropropane-1,3-diyl)bismorpholine 
4,4'-azodibenzenearsonic acid 
4,4'-diaminodiphenylmethane  
4,4'-dihydroxy-alpha-methylstilbene 
4,4-dimethyl-5alpha-cholest-8-en-3beta-ol 
4,4-dimethyl-5alpha-cholesta-8,14,24-trien-3beta-ol  
4,5,6-trimethyl-3-pentadecylcatechol 
4,6,8-trimethyl-1-nonene 
4,6-di-O-sulfo-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp2Me-(1->2)-4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-ManpOMe 
4,6-dimethyldodecane 
4,6-dimethylundecane 
4,6-dioxoheptanoic acid  
4,8,12-trimethyltridecanoyl-CoA(4-) 
4-(1-hydroxyethyl)phenol 
4-(18,20-dihydroxy-26-methoxy-25-methyloctacosyl)phenyl 3,6-di-O-methyl-beta-D-Glc-(1->4)-2,3-di-O-methyl-alpha-L-Rha-(1->2)-3-O-methyl-alpha-L-Rha 
4-(2-aminophenyl)-2,4-dioxobutanoate 
4-(2-aminophenyl)-2,4-dioxobutanoic acid 
4-(2-hydroxy-5-methylphenylazo)acetanilide 
4-(2-nitrobutyl)morpholine 
4-(2-thienyl)butyric acid 
4-(4-nitrophenylazo)aniline 
4-(4-styrylphenylcarbamoyl)butyric acid 
4-(5-ethyl-2-thienyl)-4-oxobutyric acid 
4-(\{5-[(2-aminoethyl)amino]-2,4-dinitrophenyl\}amino)-TEMPO 
4-(ethoxymethylene)-2-phenyloxazol-5-one  
4-(phenylazo)aniline 
4-(phosphonooxy)-L-threonine 
4-(trimethylammonio)butanoate  
4-(trimethylammonio)butanoic acid +   
4-[(1S,2R)-3-(4-fluorophenyl)-2-hydroxy-1-(1,2,4-triazol-1-yl)propyl]benzonitrile 
4-[4-(3,5-dioxohexyl)phenylcarbamoyl]butyric acid 
4-[N'-(2-hydroxyethyl)thioureido]-L-benzyl EDTA 
4-acetamidobutanal 
4-acetamidobutanoate 
4-aminobenzenesulfonic acid 
4-aminobenzoic acid +   
4-aminobutanal 
4-aminobutyl alpha-L-fucopyranoside 
4-aminobutyl beta-D-xylopyranoside 
4-aminophenol +   
4-ammoniobutanal 
4-bromophenol 
4-chlorobenzoyl group 
4-coumaroyl-CoA(4-) 
4-diazoniobenzenesulfonate +  
4-diazoniobenzoate +  
4-diazoniophenylphosphorylcholine 
4-ethylphenyl sulfate 
4-ethylphenyl sulfate(1-) 
4-fumarylacetoacetate(2-) 
4-guanidinobutanoic acid 
4-hydroxy-1-pyrroline-2-carboxylic acid +  
4-hydroxy-2-oxoglutarate(2-) +  
4-hydroxy-8-methoxyquinaldic acid 
4-hydroxy-L-prolinate 
4-hydroxy-L-proline zwitterion 
4-hydroxybenzaldehyde 
4-hydroxynon-2-enal +   
4-hydroxyphenyl acetate 
4-hydroxyphenylacetate 
4-hydroxyphenylacetic acid +   
4-hydroxyphenylacetyl-CoA 
4-hydroxyphenylacetylglycine 
4-hydroxyproline +  
4-isopropenyl-2-oxocyclohexane-1-carbonyl-CoA 
4-isopropyl-1-methylcyclohexane 1-hydroperoxide 
4-maleylacetoacetate 
4-methoxy-17beta-estradiol +   
4-methoxyestrone +  
4-methyl-1,4-dihydropyridine-3,5-dicarbaldehyde 
4-methyl-2-oxopentanoate 
4-methyl-2-oxopentanoic acid  
4-methylaminophenol +  
4-methylcatechol +   
4-methylpentanal  
4-methylthio-2-oxobutanoate +  
4-methylundecane 
4-nitrobenzyl bromide  
4-nitrophenol +   
4-nitrophenyl (4-carboxybutyl)phosphonate 
4-nitrophenyl hydrogen sulfate  
4-nitrophenyl methylphosphonate 
4-nitrophenyl phosphate  
4-nitrosobenzenesulfonamide 
4-O-(2-acetamido-2-deoxy-beta-D-glucopyranosyl)-5-O-phosphono-D-ribitol 
4-O-(2-acetamido-2-deoxy-beta-D-glucopyranosyl)-D-ribitol +  
4-O-acetyl-2,3-di-O-methyl-alpha-L-fucopyranose 
4-oxo-4-(2-thienyl)butyric acid 
4-oxo-4-phenylbutyric acid 
4-oxobutanoate 
4-phospho-D-erythronic acid 
4-pyridoxate 
4-pyridoxic acid +   
4-sulfanilamidobenzoic acid 
4-tert-butylphenol +   
4-tolyl isocyanate  
4-trimethylammoniobutanal 
4a-hydroxytetrahydrobiopterin +  
4alpha-formyl-4beta-methyl-5alpha-8-cholesten-3beta-ol 
4alpha-formyl-5alpha-cholest-8-en-3beta-ol 
4alpha-hydroxymethyl-4beta-methyl-5alpha-8-cholesten-3beta-ol 
4alpha-hydroxymethyl-4beta-methylzymosterol 
4alpha-hydroxymethyl-5alpha-cholest-8-en-3beta-ol 
4alpha-methyl-5alpha-cholest-8-en-3-one 
4alpha-methyl-5alpha-cholest-8-en-3beta-ol 
4alpha-methyl-5alpha-ergosta-8,14,24(28)-trien-3beta-ol 
4alpha-methylzymosterol 
4beta-hydroxycholesterol  
4beta-methylzymosterol-4-carbaldehyde 
4beta-methylzymosterol-4alpha-carboxylic acid 
5'-acetylphosphoadenosine 
5'-adenylyl sulfate +   
5'-adenylyl sulfate(2-) 
5'-CGAAAGUCCGAUCGGCGUAAUGUCA-3' RNA fragment 
5'-CGTGCTGTTTTTTTTTG-3' 
5'-CGUUCGCG-3' RNA fragment 
5'-deoxyadenosine 
5'-GACCCCUG-3' RNA fragment 
5'-GUUUGGCGACGUCCCACAUGAGCC-3' RNA fragment 
5'-S-methyl-5'-thioadenosine  
5'-TCGAGCTGCCTTCAGTCGT-3' 
5'-xanthylate(2-) 
5'-xanthylic acid +  
5(S),6(S)-epoxy-18(S)-hydroxy-(7E,9E,11Z,14Z,16E)-icosapentaenoic acid 
5(S)-HETE 
5(S)-HPETE 
5(S)-HPETE(1-) 
5,6,7,8-tetrahydrobiopterin +   
5,6,7,8-tetrahydrofolyl-L-glutamic acid 
5,6-DHET 
5,6-dihydrothymine 
5,6-dihydrouracil 
5,6-dihydroxyindole 
5,6-dihydroxyindole-2-carboxylate 
5,6-dihydroxyindole-2-carboxylic acid  
5,6-dimethyl-3-pentadecylcatechol 
5,6-dimethylbenzimidazole 
5,6-EET +   
5,6beta-epoxy-5beta-cholestane 
5,7-icosanedione 
5-(2-amino-5,6-dimethyl-1H-benzimidazol-1-yl)pentanoic acid 
5-(2-carboxylatoethyl)-4-oxo-4,5-dihydro-1H-imidazol-5-ide 
5-(2-hydroxyethyl)-4-methylthiazole 
5-(\{4-[2-(1-oxidopiperidin-1-yl)ethyl]phenyl\}amino)-5-oxopentanoic acid 
5-(dimethylamino)-N-(4-nitrosobenzyl)naphthalene-1-sulfonamide 
5-(hydroxymethyl)cytosine +   
5-(methylsulfanyl)-2,3-dioxopentyl phosphate(2-) 
5-[(2-aminobenzimidazol-6-yl)amino]-5-oxopentanoic acid 
5-[(4,6-diamino-1,3,5-triazin-2-yl)amino]-4-hydroxy-3-[(2-sulfophenyl)diazenyl]naphthalene-2,7-disulfonic acid 
5-[(4-nitrobenzyl)(phosphonomethyl)amino]valeric acid 
5-[2-(2-oxoethoxy)ethoxy]-diclofenac 
5-\{[4-(\{hydroxy[(4-nitrophenyl)amino]phosphoryl\}methyl)phenyl]amino\}-5-oxopentanoic acid 
5-acetamido-6-formamido-3-methyluracil  
5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide(2-) 
5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylic acid 
5-amino-1-(5-phosphonato-D-ribosyl)imidazol-3-ium 
5-amino-1-(5-phosphonato-D-ribosyl)imidazole-4-carboxylate 
5-amino-2-chlorobenzotrifluoride 
5-amino-2-oxopentanoic acid 
5-amino-6-(5-phospho-D-ribitylamino)uracil 
5-amino-6-(D-ribitylamino)uracil 
5-aminoimidazole-4-carboxamide  
5-aminolevulinic acid +   
5-aminopentanoic acid +  
5-diphospho-1D-myo-inositol pentakisphosphate 
5-dodecenoate 
5-dodecenoic acid +  
5-formamido-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide 
5-formamido-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide(2-) 
5-formimidoyltetrahydrofolate(2-) 
5-formimidoyltetrahydrofolic acid 
5-formyltetrahydrofolic acid +   
5-formyluracil 
5-guanidino-2-oxopentanoic acid 
5-HEPE 
5-HETE +  
5-hydroperoxy-15-HETE +  
5-hydroxy-2-oxo-4-ureido-2,5-dihydro-1H-imidazole-5-carboxylic acid 
5-hydroxy-L-tryptophan 
5-hydroxy-N-formylkynurenine +  
5-hydroxybenzimidazole 
5-hydroxydiclofenac  
5-hydroxyindole  
5-hydroxyisouric acid +  
5-hydroxykynurenamine +  
5-hydroxykynurenine +  
5-hydroxymethyluracil +  
5-hydroxytryptophan +  
5-methylcytosine +   
5-methyldec-1-ene 
5-methyldihydrofolic acid 
5-methyltetrahydrofolate(2-) 
5-O-phosphonato-alpha-D-ribofuranosyl diphosphate(5-) 
5-O-phosphono-alpha-D-ribofuranosyl diphosphate 
5-oxo-ETE  
5-oxoprolinate +  
5-oxoproline +   
5-PAHSA 
5-PAHSA(1-) 
5-phospho-beta-D-ribosylamine 
5-phospho-beta-D-ribosylaminium(1-) 
5alpha-androstane +   
5alpha-androstane-3,17-dione 
5alpha-androstane-3alpha,17beta-diol +  
5alpha-androstane-3beta,17beta-diol +  
5alpha-cholest-7-en-3beta-ol +   
5alpha-cholest-8-en-3beta-ol 
5alpha-cholesta-7,24-dien-3beta-ol 
5alpha-pregnane-3,20-dione  
5beta-androstane-3,17-dione 
5beta-cholestan-3-one 
5beta-cholestane-3alpha,7alpha,12alpha,26-tetrol +  
5beta-cholestane-3alpha,7alpha,12alpha-triol 
5beta-cholestane-3alpha,7alpha,26-triol 
5beta-cholestane-3alpha,7alpha-diol 
5beta-dihydroaldosterone 
5beta-dihydrocorticosterone 
5beta-dihydrotestosterone 
5beta-pregnane-3,20-dione 
6,7-dihydrobiopterin +  
6,8-icosanedione 
6-(2-amino-2-carboxyethyl)-4-hydroxybenzothiazole 
6-(alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol +  
6-(alpha-D-glucosaminyl)-1D-myo-inositol 
6-(alpha-D-glucosaminyl)-1D-myo-inositol 1,2-cyclic phosphate 
6-(alpha-D-glucosaminyl)-O-acyl-1-phosphatidyl-1D-myo-inositol 
6-(N-acetyl-alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol 
6-(N-acetyl-alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol(1-) 
6-(O-phosphocholine)oxyhexanoate 
6-(O-phosphocholine)oxyhexanoic acid 
6-(O-phosphocholine)oxyhexanoic acid betaine 
6-[(4-aminobenzyl)amino]-2,3,4,5-tetrahydropyridinium 
6-[6-(2-aminoethylphosphoryl)-alpha-mannosyl-(1->6)-2-(2-aminoethylphosphoryl)-alpha-mannosyl-(1->6)-alpha-2-(2-aminoethylphosphoryl)mannosyl-(1->4)-alpha-glucosaminyl]-O-acyl-1-phosphatidyl-1D-myo-inositol +  
6-\{4-[hydroxy-(4-nitrophenoxy)phosphoryl]butyrylamino\}hexanoic acid 
6-amino-2-oxohexanoic acid +  
6-aminopenicillanic acid +   
6-deoxy-alpha-L-Talp2,3Ac2-(1->3)-beta-D-Glcp-yl group 
6-deoxy-alpha-L-Talp2Ac3Me-(1->3)-beta-D-Glcp-yl group 
6-hydroxymelatonin  
6-hydroxymethyladenine 
6-hydroxynicotinic acid 
6-lactoyl-5,6,7,8-tetrahydropterin +  
6-methyladenine 
6-methylcoumarin 
6-O-[alpha-D-mannosyl-(1->4)-alpha-D-glucosaminyl]-O-acyl-1-phosphatidyl-1D-myo-inositol 
6-O-\{2-O-[(2-aminoethyl)phosphoryl]-alpha-D-mannosyl-(1->4)-alpha-D-glucosaminyl\}-O-acyl-1-phosphatidyl-1D-myo-inositol 
6-O-\{alpha-D-mannosyl-(1->2)-alpha-D-mannosyl-(1->6)-2-O-[(2-aminoethyl)phosphoryl]-alpha-D-mannosyl-(1->4)-alpha-D-glucosaminyl\}-O-acyl-1-phosphatidyl-1D-myo-inositol 
6-O-\{alpha-D-mannosyl-(1->6)-2-O-[(2-aminoethyl)phosphoryl]-alpha-D-mannosyl-(1->4)-alpha-D-glucosaminyl\}-O-acyl-1-phosphatidyl-1D-myo-inositol 
6-O-butyryl-N-acetylmuramyl-L-alanyl-D-isoglutamine N-hydroxy-5-norbornene-2,3-dicarboxylmidyl ester 
6-O-phosphonato-D-glucono-1,5-lactone(2-) 
6-O-phosphono-D-glucono-1,5-lactone 
6-oxoprostaglandin F1alpha  
6-phospho-2-dehydro-D-gluconic acid 
6-tuliposide A 
6beta-(\{5-[(p-aminophenyl)imino]pentylidene\}amino)penicillanic acid 
6beta-[(p-hydroxybenzylidene)amino]penicillanic acid 
6beta-hydroxycortisol  
6beta-hydroxycortisone 
6beta-hydroxyestrone 
6beta-hydroxytestosterone +   
7,10,13,16-docosatetraenoic acid 
7,8-dihydro-7-hydroxy-8S-glutathionylbenzo[a]pyrene 
7,8-dihydroneopterin +  
7,8-dihydroneopterin 3'-phosphate 
7,8-dihydroneopterin 3'-triphosphate 
7,8-dihydroneopterin 3'-triphosphate(4-) 
7,9-dihydro-1H-purine-2,6,8(3H)-trione +   
7-(2-amino-2-carboxyethyl)-5-hydroxy-2H-1,4-benzothiazine-3-carboxylic acid 
7-(2-amino-2-carboxyethyl)-5-hydroxy-3,4-dihydro-2H-1,4-benzothiazin-3-one 
7-dehydrodesmosterol 
7-methyl-3-oxooct-6-enoyl-CoA 
7-methylguanine +   
7-methylxanthine 
7-oxo-5alpha-cholestan-3beta-ol 
7-oxolithocholic acid +   
7-PAHSA 
7-PAHSA(1-) 
7alpha -hydroxytestosterone 
7alpha,12alpha-dihydroxy-3-oxo-5beta-cholan-24-oic acid +  
7alpha,12alpha-dihydroxy-5beta-cholestan-3-one 
7alpha,12alpha-dihydroxycholest-4-en-3-one 
7alpha,25-dihydroxy-4-cholesten-3-one 
7alpha,25-dihydroxycholesterol 
7alpha,26-dihydroxycholesterol +  
7alpha-hydroxy-3-oxo-4-cholestenoic acid 
7alpha-hydroxy-3-oxo-5beta-cholan-24-oic acid 
7alpha-hydroxy-5beta-cholestan-3-one 
7alpha-hydroxycholest-4-en-3-one  
7alpha-hydroxycholesterol  
8(S),15(S)-DiHETE 
8(S),15(S)-DiHPETE 
8(S)-HPETE 
8,11,14-icosatrien-5-ynoic acid 
8,9-EET +   
8-aminooctanoic acid 
8-benzyl-7-hydroxy-4,10-dioxo-1-phenyl-6-oxa-3,9-diaza-7-phosphatetradecan-14-oic acid 7-oxide 
8-epi-prostaglandin E2  
8-HETE +  
8-hydroxyadenine 
8-nitroguanosine 3',5'-cyclic monophosphate 
8-oxoadenine 
8-PAHSA 
8-PAHSA(1-) 
9(S)-HPETE 
9(S)-HPODE 
9,10-epoxyoctadecanoic acid +  
9-(2-carboxyethyl)-10-methylanthracene endoperoxide 
9-deoxy-9-acetamido-alpha-N-acetylneuraminyl-(2->6)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
9-deoxy-9-acetamido-N-acetyl-alpha-neuraminic acid 
9-HODE +   
9-PAHSA 
9-PAHSA(1-) 
9E,11E-octadecadienoic acid +   
9xi-episterol +  
[3)-6-deoxy-alpha-L-Talp-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp2,4Ac2-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp2Ac-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp2Me-(1->3)-beta-D-Glcp-(1->]n 
[3)-6-deoxy-alpha-L-Talp4Ac2Me-(1->3)-beta-D-Glcp-(1->]n 
[3)-alpha-D-Galp-(1->3)-beta-D-Galf2Ac-(1->]n 
[3)-beta-D-Glcp-(1->]5 
[3)-beta-D-Glcp6,NAc2-(1->] residue 
[3)-beta-D-GlcpNAc-(1->4)-alpha-L-Rhap-(1->]n 
[3)alpha-L-Rhap-(1->2)-alpha-D-Galp-(1->3)-alpha-D-GlcpNAc-(1->3)-alpha-L-Rhap(1->]4 
[4)-alpha-D-GalNAcAN-(1->4)-alpha-D-GalNAcAN-(1->3)-beta-D-QuiNAc-(1->2)-beta-D-QuiN4Fm-(1->4)-alpha-D-GalNAcAN-(1->4)-alpha-D-GalNAcAN-(1->]n 
[4)-alpha-D-Galp-(1->3)-beta-D-Galf-(1->]n 
[4)-alpha-D-Glcp-(1->4)-alpha-D-Glcp-(1->4)-alpha-D-Glcp-(1->] residue 
[4)-beta-D-Galp-(1->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->]n 
[N-(4-cyanophenyl)-N'-(diphenylmethyl)guanidine]acetic acid  
\{[(1r,7r)-4-(4-acetamidophenyl)-3,5-dioxo-4-azatricyclo[5.2.2.0(2,6)]undec-1-yl]carbamoyloxy\}acetic acid 
Ac-Asp-Glu  
acenaphthoquinone  
acetaldehyde +   
acetate +   
acetoacetate 
acetoacetyl-[acp] 
acetoacetyl-CoA  
acetoacetyl-CoA(4-) 
acetone +   
acetyl dihydrogen phosphate 
acetyl-[acyl-carrier protein] 
acetyl-CoA(4-) 
acetylcholine +   
acrylate +   
acryloyl-CoA  
acryloyl-CoA(4-) 
acyl-carrier protein +  
acylglycerone phosphate +  
adenine +   
adenosine +   
adenosine 3',5'-bismonophosphate +   
adenosine 3',5'-bismonophosphate(4-) 
adenosine 5'-monophosphate(2-) +  
adenosylcob(III)yrinic acid a,c-diamide 
adenosylcobinamide 
adenylyl selenate 
ADP +   
ADP alpha-D-glucoside(2-) 
ADP(3-) +  
ADP-alpha-D-mannose 
ADP-D-ribose +   
ADP-D-ribose 2'-phosphate 
ADP-D-ribose 2'-phosphate(4-) 
ADP-D-ribose(2-) +  
adrenaline +   
aflatoxin B1 +   
aflatoxin B1 exo-8,9-epoxide  
agmatine +   
agmatinium(2+) 
AICA ribonucleotide  
Ala-tRNA(Ala) 
aldehydo-D-xylose +  
aldehydo-L-iduronate 
aldehydo-N-acetyl-D-glucosamine 
aldehydo-N-acetyl-D-mannosamine 
aldehydo-N-acyl-D-mannosamine 6-phosphate +  
aldosterone +   
alkylphosphonate 
all-cis-5,8,11,14,17-icosapentaenoate +  
all-cis-5,8,11,14,17-icosapentaenoic acid +  
all-cis-docosa-4,7,10,13,16,19-hexaenoic acid +   
all-cis-docosa-7,10,13,16-tetraenoic acid +   
all-cis-icosa-8,11,14-trienoic acid +  
all-cis-icosa-8,11,14-trienoyl-CoA 
all-cis-octadeca-6,9,12,15-tetraenoic acid +  
all-trans-4-hydroxyretinoic acid +   
all-trans-4-hydroxyretinol 
all-trans-4-oxoretinal  
all-trans-dodecaprenyl diphosphate 
all-trans-dodecaprenyl diphosphate(3-) 
all-trans-hexaprenyl diphosphate 
all-trans-retinal +   
all-trans-retinoate +  
all-trans-retinoic acid +   
all-trans-retinol +   
allantoate 
allantoic acid 
allantoin +   
allocholic acid +  
allyl octadecyl oxalate 
alpha,alpha-trehalose +   
alpha,N-(epsilon,N-DNP-aminocaproyl)-epsilon,N-DNP-L-lysine dicyclohexylammonium salt 
alpha-aminobutyrate 
alpha-aminobutyric acid +  
alpha-D-Abep-(1->3)-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp 
alpha-D-fucose +  
alpha-D-fucoside 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal +  
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-D-GlcNAc +  
alpha-D-Gal-(1->3)-beta-D-Gal-(1->3)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-D-GlcNAc +  
alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/16:0) 
alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/18:0) 
alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/20:0) 
alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/22:0) 
alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/22:1) 
alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/23:0) 
alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:0) 
alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:1(15Z)) 
alpha-D-galactosaminyl-(1->3)-[alpha-L-fucosyl-(1->2)]-beta-D-galactosyl derivative(1+) 
alpha-D-galactose +   
alpha-D-galactose 1-phosphate  
alpha-D-galactose 1-phosphate(2-) 
alpha-D-galactosyl-(1->2)-alpha-D-galactose 
alpha-D-galactosyl-(1->2)-beta-D-galactose +  
alpha-D-galactosyl-(1->2)-D-galactose +  
alpha-D-galactosyl-(1->2)-D-galactosyl group 
alpha-D-galactosyl-(1->3)-1D-myo-inositol 
alpha-D-galactosyl-(1->3)-alpha-D-galactose +  
alpha-D-galactosyl-(1->3)-beta-D-mannose 
alpha-D-galactosyl-(1->3)-D-galactose +  
alpha-D-galactosyl-(1->3)-D-galactosyl group 
alpha-D-galactosyl-(1->4)-beta-D-galactosyl group +  
alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide +   
alpha-D-galactosyl-(1->4)-beta-D-galactosyl-N-(pentacosanoyl)sphingosine 
alpha-D-GalNAc-(1->2)-beta-D-Man-(1->4)-[beta-D-Glc-(1->2)]-alpha-D-Man-(1->5)-alpha-Kdo 
alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1->1')-Cer 
alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-\{alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1->1')-Cer 
alpha-D-GalNpAc-(1->3)-beta-D-GalpNAc 
alpha-D-Galp-(1->2)-[alpha-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp 
alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-D-Galp-(1->2)-[alpha-D-Tyvp-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-D-Tyvp-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-D-Galp-(1->3)-[alpha-D-Galp-(1->4)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1->1')-Cer 
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-Galp-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1->1')-Cer 
alpha-D-Galp-(1->3)-alpha-D-Glcp-(1->3)-alpha-L-Rhap-(1->3)-D-ribitol 
alpha-D-Galp-(1->3)-alpha-D-Glcp-(1->3)-alpha-L-Rhap-(1->3)-D-ribitol-5-phosphate 
alpha-D-Galp-(1->3)-alpha-D-Glcp-(1->3)-alpha-L-Rhap-(1->4)-D-ribitol 
alpha-D-Galp-(1->3)-alpha-D-Glcp-(1->3)-alpha-L-Rhap-(1->4)-D-ribitol-5-phosphate 
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group 
alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group +  
alpha-D-Galp-(1->4)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-D-Galp-(1->4)-beta-D-GalpNAc-(1->3)-D-Galp 
alpha-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GalpN-(1->4)-alpha-D-GalpA-yl group 
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-Glcp +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-yl group +  
alpha-D-GalpNAc-(1->3)-beta-D-Galp 
alpha-D-GalpNAc-(1->4)-[alpha-D-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcNAc-(1->4)-beta-D-GlcA-(1->4)-alpha-D-GlcNAc-(1->4)-beta-D-GlcA-(1->3)-beta-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-Xyl-(1->3)-L-Ser 
alpha-D-GlcNAc6S-(1->4)-D-GlcA 
alpha-D-Glcp-(1->3)-alpha-D-Glcp-(1->3)-alpha-L-Rhap-(1->3)-D-ribitol 
alpha-D-Glcp-(1->3)-alpha-D-Glcp-(1->3)-alpha-L-Rhap-(1->3)-D-ribitol-5-phosphate 
alpha-D-Glcp-(1->3)-alpha-L-Rhap 
alpha-D-Glcp-(1->3)-alpha-L-Rhap-(1->3)-D-ribitol 
alpha-D-Glcp-(1->3)-alpha-L-Rhap-(1->4)-D-ribitol 
alpha-D-Glcp-(1->6)-alpha-D-Glcp-(1->6)-beta-D-Glcp 
alpha-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->3)-D-GalpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-D-glucosamine 6-phosphate 
alpha-D-glucose +   
alpha-D-glucose 1,6-bisphosphate 
alpha-D-glucose 1,6-bisphosphate(4-) 
alpha-D-glucose 1-phosphate(2-) 
alpha-D-glucose 6-phosphate 
alpha-D-glucose-1,2-((13)C2) 
alpha-D-glucosyl-(1->3)-beta-D-mannose 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc-4P-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo 
alpha-D-Kdo-(2->8)-[alpha-D-Kdo-(2->4)]-alpha-D-Kdo-(2->4)-alpha-D-Kdo 
alpha-D-Kdo-(2->8)-[alpha-D-Kdo-(2->4)]-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcN-4P-(1->6)-alpha-D-GlcN-1P 
alpha-D-Kdo-(2->8)-[alpha-D-Kdo-(2->4)]-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc4P-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc-4P-(1->6)-alpha-D-GlcNAc 
alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc 
alpha-D-Man-(1->2)-alpha-D-Man-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->3)-[alpha-D-Man-(1->2)-alpha-D-Man-(1->6)]-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-D-Man-(1->3)-[alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-2-alpha-D-GlcNAc(PP-Dol) 
alpha-D-mannose +  
alpha-D-mannose 1-phosphate(2-) 
alpha-D-mannose 6-phosphate +  
alpha-D-mannosyl-beta-D-mannosyldiacetylchitobiosyldiphosphodolichol 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-D-Manp +  
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-alpha-D-Manp 
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-DManp-(1->6)]-alpha-D-Manp 
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-beta-D-Manp 
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc +  
alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-D-Manp-(1->6)-beta-D-Manp 
alpha-D-Manp6P-(1->3)-alpha-D-Manp-(1->3)-alpha-D-Manp-(1->3)-alpha-D-Manp-(1->2)-D-Manp +  
alpha-D-Rhap-(1->2)-alpha-D-Rhap-(1->3)-alpha-D-Rhap 
alpha-D-Rhap-(1->3)-alpha-D-Rhap 
alpha-D-Rhap-(1->3)-alpha-D-Rhap-(1->2)-alpha-D-Rhap 
alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo 
alpha-D-Rhap4NFo-(1->3)-alpha-D-Rhap4NFo +  
alpha-D-ribofuranose 5-phosphate 
alpha-D-ribose 1-phosphate(2-) 
alpha-Fuc-(1->2)-[alpha-Fuc-(1->2)-beta-Gal-(1->3)-alpha-GalNAc-(1->3)]-beta-Gal-(1->4)-beta-GlcNAc-(1->3)-beta-Gal-(1->4)-beta-Glc-(1<->1')-Cer 
alpha-GalNAc-(1->3)-[alpha-Fuc-(1->2)]-beta-Gal-(1->3)-alpha-GalNAc-(1->3)-[alpha-Fuc-(1->2)]-beta-Gal-(1->4)-beta-GlcNAc-(1->3)-beta-Gal-(1->4)-beta-Glc-(1->1')-Cer 
alpha-KDN-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-KDN-(2->3)-beta-D-Galp-(1->4)-D-Glcp 
alpha-KDN-(2->6)-beta-D-Galp-(1->4)-D-GlcpNAc 
alpha-Kdo-(2->8)-[alpha-Kdo-(2->4)]-alpha-Kdo 
alpha-L-arabinofuranose +  
alpha-L-Araf-(1->2)-beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->3)-alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1->1')-Cer +  
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1->1')-Cer 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-D-GlcNAc 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]GlcNAc-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1->1')-Cer 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->6)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1->1')-Cer +  
alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1->1')-Cer +  
alpha-L-Fuc-(1->3)-[beta-D-Gal-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-L-Fuc-(1->3)-[beta-D-Gal-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-L-Fuc-(1->3)-beta-D-GalNAc-(1->4)-beta-D-GlcNAc-yl group 
alpha-L-fucose +  
alpha-L-fucoside +  
alpha-L-fucosyl group +  
alpha-L-fucosyl-(1->2)-beta-D-galactosyl group 
alpha-L-fucosyl-(1->3)-N-acetyl-beta-D-glucosamine 
alpha-L-fucosyl-(1->4)-N-acetyl-beta-D-glucosamine 
alpha-L-Fucp-(1->2)-(1->3)-[alpha-D-Galp]-beta-D-Galp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-alpha-D-GalpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-beta-D-Galp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-beta-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-Galp-(1->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-alpha-D-GalpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-Galp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-L-Fucp-(1->2)-[alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group +  
alpha-L-Fucp-(1->2)-[beta-D-Galp-(1->3)-alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-D-Glcp 
alpha-L-Fucp-(1->2)-[beta-D-Galp-(1->3)-alpha-D-GalpNAc-(1->3)]-beta-D-Galp-(1->4)-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-\{alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-(1->6)\}-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-Glcp6S 
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-GlcpNAc6S +  
alpha-L-Fucp-(1->2)-beta-D-Galp6S-(1->4)-D-Glcp +  
alpha-L-Fucp-(1->2)-beta-D-Galp6S-(1->4)-D-Glcp6S +  
alpha-L-Fucp-(1->2)-beta-D-Galp6S-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)]-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-[alpha-Neup5Ac-(2->3)-beta-D-Galp6S-(1->4)]-beta-D-GlcpNAc 
alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-yl group 
alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-D-GlcpNAc +  
alpha-L-Fucp-(1->4)-[beta-D-Galp3S-(1->3)]-beta-D-GlcpNAc 
alpha-L-FucpNAc-(1->3)-D-FucpNAc 
alpha-L-rhamnopyranose +   
alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->2)-alpha-L-Rhap 
alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->3)-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-L-Rhap 
alpha-L-Rhap-(1->3)-alpha-D-Galp 
alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap 
alpha-L-Rhap-(1->3)-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc 
alpha-L-Rhap-(1->3)-D-ribitol 
alpha-L-Rhap-(1->4)-D-ribitol 
alpha-linolenate +  
alpha-linolenic acid +   
alpha-linolenoyl-CoA 
alpha-maltotriose +  
alpha-Man-(1->2)-alpha-Man-(1->2)-alpha-Man-(1->3)-[alpha-Man-(1->2)-alpha-Man-(1->3)-[alpha-Man-(1->2)-alpha-Man-(1->6)]-alpha-Man-(1->6)]-beta-Man-(1->4)-beta-GlcNAc-(1->4)-alpha-GlcNAc(PP-Dol) 
alpha-Man-(1->2)-alpha-Man-(1->2)-alpha-Man-(1->3)-[alpha-Man-(1->2)-alpha-Man-(1->3)-alpha-Man-(1->6)]-beta-Man-(1->4)-beta-GlcNAc-(1->4)-alpha-GlcNAc(PP-Dol) 
alpha-Man-(1->2)-alpha-Man-(1->2)-alpha-Man-(1->3)-[alpha-Man-(1->6)-[alpha-Man-(1->2)-alpha-Man-(1->3)]-alpha-Man-(1->6)]-beta-Man-(1->4)-beta-GlcNAc-(1->4)-alpha-GlcNAc(PP-Dol) 
alpha-methyl-L-dopa +   
alpha-mycolic acid 
alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-N-acylsphingosine +   
alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-N-acylsphingosine(1-) +  
alpha-N-acetylneuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl group 
alpha-N-acetylneuraminyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-ceramide +  
alpha-N-acetylneuraminyl-(2->3)-D-galactosyl group +  
alpha-N-acetylneuraminyl-(2->6)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine 
alpha-Neu5Ac-(2->3)-beta-D-Gal (1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-Neu5Ac-(2->3)-beta-D-Gal(1->3)beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-Gal-(1->4)-beta-Glc-(1->1')-Cer(d18:1/18:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-(1->6)]-D-GalNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->6)]-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->6)]-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->6)]-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/20:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/22:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/22:1) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/23:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:1(15Z)) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:2) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/18:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/22:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/16:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/18:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/20:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/21:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/22:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/22:1(13Z)) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/23:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:0) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:1(15Z)) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:2) 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-yl group +  
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-Neu5Ac-(2->6)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-Neu5Ac-(2->3)-D-Gal +  
alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-D-Glc-(1<->1')-Cer 
alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-Gal-(1->4)-beta-Glc-(1<->1')-Cer 
alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-beta-Gal-(1->4)-beta-Glc-(1<->1')-Cer 
alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-D-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
alpha-Neu5NAc-(2->8)-alpha-Neu5NAc-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
alpha-Neu9,NAc2-(2->6)-GalNAc 
alpha-NeuNAc-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-NeuNAc-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
alpha-Neup5,9Ac2-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5,9Ac2-(2->6)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GalpNAc 
alpha-Neup5Ac-(2->3)-alpha-D-GalpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp-(1<->1')-Cer +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-D-GalpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-GlcpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-D-Galp-yl group 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[beta-D-Galp-(1->4)-beta-D-Glcp-(1->6)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1->6)]-2,5-anhydro-D-Man 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-GalpNAc 
alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S 
alpha-Neup5Ac-(2->3)-beta-D-Galp6S-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)]-alpha-D-GalpNAc 
alpha-Neup5Ac-(2->6)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)]-D-GalpNAc +  
alpha-Neup5Ac-(2->6)-beta-D-Galp 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-GalpNAc 
alpha-Neup5Ac-(2->6)-beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->6)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac +  
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp-yl group +  
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-[beta-D-GalpNAc-(1->4)]-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-yl group 
alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->8)-beta-Neup5Ac 
alpha-Neup5Ac-(2->8)-beta-Neup5Ac 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcNAcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
alpha-Neup5Gc-(2->3)-beta-D-Galp-(1->4)-D-Glcp-yl group 
alpha-Neup5Gc-(2->6)-alpha-D-GalpNAc 
alpha-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
alpha-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-D-Glcp-yl group 
alpha-Neup5NAc-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1<->1')-Cer 
alpha-NeupNAc-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S 
alpha-phenylglycine +   
alpha-pinene oxide 
alpha-ribazole +  
alpha-ribazole 5'-phosphate 
aminoacetone  
aminomalonic acid  
ammonia +   
ammonioacetone 
ammonium +   
amoxicillin diketopiperazine 
amoxicilloic acid 
amylose +   
androst-4-ene-3,17-dione +   
androst-5-ene-3beta,17beta-diol  
androstane-3,17-dione +   
androsterone +   
androsterone 3-glucosiduronic acid  
androsterone sulfate 
anserine 
anthranilate +  
anthranilic acid +   
anthrarobin  
AP4 hapten 
apo-[acyl-carrier protein] 
apoprotein +  
aquacob(III)alamin 
arabinitol +  
arachidonate +  
arachidonic acid +   
arachidonoyl-CoA(4-) 
Arg-tRNA(Arg) 
argpyrimidine 
artemoin A 
artemoin B 
artemoin C 
artemoin D 
artemorin 
Asn-tRNA(Asn) 
Asp-tRNA(Asn) 
Asp-tRNA(Asp) 
Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 
asparagoside F 
aspirin-triggered resolvin D4 
ATP(3-) 
ATP(4-) +  
aztreonyl group +  
Bandrowski's base  
barbituric acid +   
behenate +  
benzene-1,2,4-triol  
benzenediazonium 
benzo[a]pyrene +   
benzocaine  
benzothiazine +   
benzoyl-CoA +  
benzoylacetyl-CoA 
benzylamine +   
benzylpenamaldate group 
benzylpenamidyl group 
benzylpenicanyl group 
benzylpenicillenate +  
benzylpenicillenic acid +  
benzylpenicillenyl group 
benzylpenicillin +   
benzylpenicilloic acid 
benzylpenicilloyl group +  
benzylpenicilloyl-benzylamine 
benzylpenilloaldehyde 
benzylpenilloic acid 
beryllium atom +   
beryllium sulfate +   
beta-(1->3)-galactobiose 
beta-alanine +   
beta-aminoarteether maleate 
beta-carotene +   
beta-cellobiose +  
beta-citrylglutamic acid 
beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)]-alpha-D-Araf-(1->5)-alpha-D-Araf +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)-alpha-D-Araf-(1->5)-alpha-D-Araf-OMe 
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)]-alpha-D-Araf-(1->5)-alpha-D-Araf-OMe +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)]-alpha-D-Araf-(1->5)-alpha-D-Araf-yl group +  
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-alpha-D-Araf-(1->5)-alpha-D-Araf 
beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-alpha-D-Araf-(1->5)-alpha-D-Araf-OMe 
beta-D-fructofuranose +   
beta-D-fructofuranose 1,6-bisphosphate  
beta-D-fructofuranose 2,6-bisphosphate  
beta-D-fructofuranose 2,6-bisphosphate(4-) 
beta-D-fructofuranose 6-phosphate 
beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->3)-\{beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-[alpha-L-Fuc-(1->6)]-beta-D-GlcNAc 
beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->3)-\{beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-beta-D-GlcNAc-(1->2)-alpha-DMan-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc 
beta-D-Gal-(1->3)-[beta-D-GlcNAc-(1->6)]-D-GalNAc +  
beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/16:0) 
beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:0) 
beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1/24:1(15Z)) 
beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-yl group +  
beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
beta-D-Gal-(1->4)-alpha-D-Glc-(1->3)-[alpha-D-GlcNAc-(1->2)]-alpha-L-Hep 
beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-[beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->4)]-alpha-D-Man-(1->3)-[beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc +  
beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->6)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->6)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[beta-D-GlcNAc-(1->6)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
beta-D-galactose +   
beta-D-galactosyl-(1->3)-alpha-D-mannose 
beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl group 
beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl group 
beta-D-galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl group 
beta-D-galactosyl-(1->3)-N-acetyl-D-galactosaminyl group 
beta-D-galactosyl-(1->4)-beta-D-galactosyl-N-(pentacosanoyl)sphingosine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-N-hexadecanoylsphinganine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-[(15Z)-tetracosenoyl]sphingosine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-[(17Z)-hexacosenoyl]sphingosine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-acylsphingosine +  
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-docosanoylsphingosine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-eicosanoylsphingosine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-hexacosanoylsphingosine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-hexadecanoylsphingosine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-octadecanoylsphingosine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-tetracosanoylsphingosine 
beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-N-tricosanoylsphingosine 
beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl group +  
beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide +  
beta-D-galactosyl-(1<->1')-N-[(15Z)-tetracosenoyl]sphinganine 
beta-D-galactosyl-(1<->1')-N-[(17Z)-hexacosenoyl]sphinganine 
beta-D-galactosyl-(1<->1')-N-docosanoylsphinganine 
beta-D-galactosyl-(1<->1')-N-eicosanoylsphinganine 
beta-D-galactosyl-(1<->1')-N-hexacosanoylsphinganine 
beta-D-galactosyl-(1<->1')-N-hexadecanoylsphinganine 
beta-D-galactosyl-(1<->1')-N-octadecanoylsphinganine 
beta-D-galactosyl-(1<->1')-N-tetracosanoylsphinganine 
beta-D-galactosyl-1,3-(N-acetyl-beta-D-glucosaminyl-1,6)-N-acetyl-D-galactosaminyl group 
beta-D-galactosyl-N-(hexacosanoyl)sphingosine 
beta-D-galactosyl-N-(tetracosanoyl)sphingosine 
beta-D-galactosyl-N-(tricosanoyl)sphingosine 
beta-D-galactosyl-N-[(15Z)-tetracosenoyl]sphingosine 
beta-D-galactosyl-N-[(17Z)-hexacosenoyl]sphingosine 
beta-D-galactosyl-N-eicosanoylsphingosine 
beta-D-galactosyl-N-octadecanoylsphingosine 
beta-D-Galf-(1->3)-alpha-D-Manp 
beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-GalNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(1-) +  
beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer +  
beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-D-Glc +  
beta-D-GalNAc-(1->4)-[alpha-Neu5Gc-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer 
beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-yl group +  
beta-D-GalNAc-(1->4)-beta-D-GalNAc-yl group 
beta-D-Galp-(1->2)-beta-D-Galp 
beta-D-Galp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->3)-L-glycero-alpha-D-manno-Hepp-(1->5)-Kdo 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc-yl group 
beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcpNAc +  
beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-D-GalpNAc +  
beta-D-Galp-(1->3)-[beta-Neup5Ac-(2->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->3)-\{alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcNAc-(1->6)\}-D-GalNAc 
beta-D-Galp-(1->3)-beta-D-Galp-(1->3)-beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp 
beta-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-Galp6P-(1->4)-alpha-D-Manp 
beta-D-Galp-(1->3)-beta-D-GalpNAc +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp-(1<->1')-Cer +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-D-Glcp +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-yl group +  
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-D-Galp-yl group 
beta-D-Galp-(1->3)-beta-D-GlcpNAc +  
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp +  
beta-D-Galp-(1->3)-D-GalpNAc +  
beta-D-Galp-(1->3)-D-GlcpNAc +  
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->6)-[beta-D-Galp-(1->3)]-beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-D-Glcp +  
beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-Glcp6S +  
beta-D-Galp-(1->4)-alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-alpha-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcNAcp-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-Galp-(1->4)-beta-D-Glcp6S 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-\{alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)\}-beta-D-Man-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc +  
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-[alpha-D-Manp-(1->3)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-D-GalpNAc +  
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)-alpha-D-GalpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-Galp-(1->4)-beta-D-GlcpNAc6S-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S-(1->3)-D-Galp 
beta-D-Galp-(1->4)-beta-D-GlcpNAc6S-(1->3)-D-Galp 
beta-D-Galp3S-(1->3-)-alpha-D-GalpNAc 
beta-D-Galp3S-(1->3-)-beta-D-GlcpNAc 
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-Glcp +  
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-Glcp6S 
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
beta-D-Galp3S-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc6S +  
beta-D-Galp3S-(1->4)-beta-D-Glcp 
beta-D-Galp3S-(1->4)-beta-D-Glcp6S 
beta-D-Galp3S-(1->4)-beta-D-GlcpNAc 
beta-D-Galp3S-(1->4)-beta-D-GlcpNAc6S 
beta-D-Galp4S-(1->4)-beta-D-GlcpNAc 
beta-D-Galp6P-(1->4)-alpha-D-Manp 
beta-D-Galp6S-(1->4)-beta-D-Glcp 
beta-D-Galp6S-(1->4)-beta-D-Glcp6S 
beta-D-Galp6S-(1->4)-beta-D-GlcpNAc 
beta-D-Galp6S-(1->4)-beta-D-GlcpNAc6S 
beta-D-Galp6S-(1->4)-beta-D-GlcpNAc6S-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S-(1->3)-D-Galp 
beta-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp 
beta-D-GalpNAc-(1->3)-alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->3)-alpha-D-GalpNAc 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-D-Galp 
beta-D-GalpNAc-(1->4)-[alpha-Neup5Gc-(2->3)]-beta-D-Galp +  
beta-D-GalpNAc-(1->4)-[alpha-Neup5Gc-(2->3)]-beta-D-Galp-(1->4)-R group +  
beta-D-GalpNAc-(1->4)-alpha-D-GalpNAc 
beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc +  
beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc 
beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->3)-alpha-D-Galp 
beta-D-GalpNAc-(1->4)-D-GlcpNAc +  
beta-D-GalpNAc4S-(1->4)-beta-D-GlcpA-(1->3)-beta-D-GalpNAc4S 
beta-D-GlcA-(1->4)-alpha-D-GlcNAc6S-(1->4)-D-GlcA 
beta-D-GlcNAc-(1->4)-MDP-Lys(L18) 
beta-D-Glcp(1->6)-alpha-D-GlcpNAc-(1->3)-alpha-L-QuipNAc-(1->3)-beta-D-GlcpNAc 
beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-Glcp-(1->3)-beta-D-GlcpO[CH2]5CO2Me 
beta-D-Glcp-(1->6)-beta-D-Glcp 
beta-D-GlcpA-(1->3)-beta-D-Galp +  
beta-D-GlcpA-(1->3)-beta-D-GlcpNAc 
beta-D-GlcpA-(1->6)-beta-D-Galp 
beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[alpha-Neup5Ac-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->4)]-[beta-D-GlcpNAc-(1->6)]-D-GlcpNAc 
beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->3)-[beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->3)-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->3)-beta-D-Galp 
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->3)-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc +  
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S-(1->3)-D-Galp 
beta-D-GlcpNAc-(1->3)-D-Manp 
beta-D-GlcpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp 
beta-D-GlcpNAc-(1->4)-[beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc +  
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc-(1->6)-alpha-D-GalpNAc 
beta-D-GlcpNAc-(1->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc6S-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
beta-D-GlcpNAc6S-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc6S-(1->3)-D-Galp 
beta-D-glucose +   
beta-D-glucose 6-phosphate 
beta-D-glucosyl-(1<->1')-N-[(15Z)-tetracosenoyl]sphinganine 
beta-D-glucosyl-(1<->1')-N-[(17Z)-hexacosenoyl]sphinganine 
beta-D-glucosyl-(1<->1')-N-docosanoylsphinganine 
beta-D-glucosyl-(1<->1')-N-eicosanoylsphinganine 
beta-D-glucosyl-(1<->1')-N-hexacosanoylsphinganine 
beta-D-glucosyl-(1<->1')-N-hexadecanoylsphinganine 
beta-D-glucosyl-(1<->1')-N-octadecanoylsphinganine 
beta-D-glucosyl-(1<->1')-N-tetracosanoylsphinganine 
beta-D-glucosyl-N-(docosanoyl)sphingosine 
beta-D-glucosyl-N-(hexacosanoyl)sphingosine 
beta-D-glucosyl-N-(octadecanoyl)sphinganine 
beta-D-glucosyl-N-(tetracosanoyl)sphingosine 
beta-D-glucosyl-N-(tricosanoyl)sphingosine 
beta-D-glucosyl-N-[(15Z)-tetracosenoyl]sphingosine 
beta-D-glucosyl-N-[(17Z)-hexacosenoyl]sphingosine 
beta-D-glucosyl-N-eicosanoylsphingosine 
beta-D-glucosyl-N-hexadecanoylsphingosine 
beta-D-glucosyl-N-octadecanoylsphingosine 
beta-D-mannose +  
beta-D-mannosyldiacetylchitobiosyldiphosphodolichol 
beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-alpha-D-Manp +  
beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-beta-D-Manp +  
beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-D-Manp +  
beta-D-QuiN4Fm-(1->4)-alpha-D-GalNAcAN-(1->4)-alpha-D-GalNAcAN-(1->3)-beta-D-QuiNAc-yl group 
beta-D-QuiN4Fm-(1->4)-alpha-D-GalNAcAN-yl group 
beta-D-Tyvp-(1->3)-beta-D-GalpN-OMe 
beta-D-Tyvp-(1->3)-beta-D-GalpN6,OMe2 
beta-D-Tyvp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-OMe 
beta-D-Tyvp-(1->3)-beta-D-GalpNAc-OMe 
beta-D-Tyvp-(1->3)-beta-D-GalpNAc6,OMe2 
beta-D-Tyvp2Me-(1->3)-beta-D-GalpN6,OMe2 
beta-D-Tyvp2Me-(1->3)-beta-D-GalpNAc-OMe 
beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->4)-beta-Glc-(1<->1')-Cer 
beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->4)-R group +  
beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->4)-beta-Glc-(1->1')-Cer 
beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->4)-beta-Glc-(1->1')-Cer(d18:1/16:0) 
beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->4)-beta-Glc-(1->1')-Cer(d18:1/18:0) 
beta-glycerylphosphocholine 
beta-L-fucosyl-(1->3)-N-acetyl-beta-D-glucosamine 
beta-L-IdopA2S-(1->3)-beta-D-GalpNAc4S-(1->4)-beta-D-GlcpA-(1->3)-beta-D-GalpNAc4S 
beta-lactam antibiotic allergen +   
beta-leucine +  
beta-melibiose 
beta-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-D-GlcpNAc 
beta-NeupNAc-(2->6)-beta-D-Galp-(1->4)-beta-D-GlcpNAc 
betaine aldehyde 
bilirubin IXalpha  
bilirubin(2-) 
biliverdin +   
biliverdin hydrochloride 
biliverdin(2-) 
biocytin +  
biotin +   
biotin amide 
biotinate +  
biotinyl-5'-AMP 
biphenyl-2,2',3-triol 
bis(2-methylundecan-2-yl) disulfide 
bis(beta-glucosyluronate)bilirubin 
bis(beta-glucosyluronic acid)bilirubin 
bis(p-nitrophenyl)phosphocholine 
Bismark brown Y 
brassicasterol +  
brexanolone 
bromobenzene +   
but-3-ynal 
butan-1-ol +   
butanal +   
butyl isothiocyanate 
butyrate +   
butyryl-CoA +   
butyryl-CoA(4-) 
C20 sphinganine +  
C20 sphingosine +  
cadaverine +   
caffeine +   
calcidiol +   
calciol +   
calcitetrol 
calcitriol +   
calcium(2+) +   
campesterol +  
carbamazepine-10,11-epoxide  
carbamoyl phosphate 
carbamoyl phosphate(2-) 
carbohydrate allergen +  
carbon dioxide  
carbon monoxide  
carbonic acid +   
carboxyacetyl-[acyl-carrier protein] 
cardiolipin +  
carnitine +   
carnitinium +  
carnosine +   
carvone +   
catechol beta-D-glucuronide 
catechol beta-D-glucuronide(1-) 
CDP +   
CDP(3-) +  
CDP-1-palmitoyl-2-arachidonoyl-sn-glycerol 
CDP-1-palmitoyl-2-arachidonoyl-sn-glycerol(2-) 
CDP-1-stearoyl-2-arachidonoyl-sn-glycerol 
CDP-1-stearoyl-2-arachidonoyl-sn-glycerol(2-) 
CDP-1-stearoyl-2-linoleoyl-sn-glycerol 
CDP-1-stearoyl-2-linoleoyl-sn-glycerol(2-) 
CDP-1-stearoyl-2-oleoyl-sn-glycerol 
CDP-1-stearoyl-2-oleoyl-sn-glycerol(2-) 
CDP-choline  
CDP-diacylglycerol +  
CDP-diacylglycerol(2-) +  
CDP-ethanolamine +  
CDP-ethanolamine(1-) 
ceramide allergen +  
cerotate +  
chenodeoxycholate +  
chenodeoxycholic acid +   
chenodeoxycholoyl-CoA 
chitin  
chloral hydrate  
chloramine T  
chloride +   
cholate +   
cholest-4-en-3-one +   
cholest-5-ene 
cholesta-5,7-dien-3beta,24S-diol 
cholesta-5,7-dien-3beta,25-diol 
cholesta-5,7-dien-3beta-ol +   
cholestanol 7alpha,8alpha-epoxide 
cholesterol +   
cholesterol sulfate  
cholesteryl (4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate 
cholesteryl (5Z,8Z,11Z,14Z,17Z-eicosapentaenoate) 
cholesteryl (7Z,10Z,13Z,16Z,19Z)-docosapentaenoate 
cholesteryl (9Z)-heptadecenoate 
cholesteryl acetate 
cholesteryl all-cis-icosa-8,11,14-trienoate 
cholesteryl arachidonate  
cholesteryl behenate 
cholesteryl henicosenoate 
cholesteryl heptadecanoate 
cholesteryl linoleate  
cholesteryl linolenate  
cholesteryl myristate  
cholesteryl nonadecenoate 
cholesteryl oleate  
cholesteryl palmitate  
cholesteryl palmitoleate 
cholesteryl pentadecanoate 
cholesteryl stearate  
cholesteryl tetracosadienoate 
cholic acid +   
choline +   
choline alfoscerate 
choline phosphate(1-) 
choloyl-CoA(4-) 
chondroitin 4'-sulfate +  
chondroitin D-glucuronate +   
ciguatoxin ABC ring fragment 
ciguatoxin ABCDE ring fragment 
ciguatoxin HIJKLM cyclic acetal 
ciguatoxin HIJKLM ring fragment 
ciguatoxin IJKLM cyclic acetal 
ciguatoxin IJKLM ring fragment 
ciguatoxin JKLM ring fragment 
CII259-273 
cis,cis-2-amino-3-(3-oxoprop-1-enyl)but-2-enedioate 
cis,cis-2-amino-3-(3-oxoprop-1-enyl)but-2-enedioic acid 
cis,cis-2-ammonio-3-(3-oxoprop-1-enyl)but-2-enedioate(1-) 
cis-3-chloroprop-2-en-1-ol 
cis-3-hydroxy-D-proline 
cis-4-hydroxy-D-proline 
cis-aconitate(3-) 
cis-dodec-3-enoyl-CoA(4-) 
cis-geranoyl-CoA 
cis-resveratrol 3-O-glucuronide 
citraconic acid  
citramalate(2-) +  
citramalic acid +  
citrulline +  
CMP-N-acetyl-beta-neuraminate(2-) 
CMP-N-acetyl-beta-neuraminic acid  
CMP-N-glycoloyl-beta-neuraminate(2-) 
CMP-N-glycoloyl-beta-neuraminic acid 
cob(I)alamin 
cob(I)yrinic acid a,c diamide 
cob(II)alamin 
cob(III)alamin 
cobalt chloride hexahydrate 
cobalt dichloride +   
cobamamide +   
cobinamide +  
cocaine  
cocaine(1+) +  
cocamidopropyl betaine 
coenzyme A +   
coenzyme A(4-) +   
coenzyme Q10  
cohibin C 
cohibin D 
coniferol +  
coproporphyrin I 
coproporphyrin III 
coproporphyrinogen I 
coproporphyrinogen III  
coproporphyrinogen III(4-) 
corticosterone +   
cortisol +   
cortisol 21-sulfate 
cortisone +   
cotinine N-oxide 
coumarin +   
creatine +   
creatinine  
crosatoside B 
crotonoyl-CoA(4-) 
CTP +   
CTP(4-) +  
cyanate +   
cyclodopa 5-beta-D-glucoside 
cyclohexyl isocyanate  
cyclohexylamine 
cyclopropylamine +  
cyromazine  
Cys-tRNA(Cys) 
cysteamine +   
cysteaminium 
cystine +   
cystine zwitterion +  
cytidine +   
cytidine 5'-monophosphate +   
cytidine 5'-monophosphate(2-) +  
cytochrome c +  
cytosine +   
D-alaninate 
D-alanine +  
D-alaninium 
D-alpha-D-Hepp-(1->6)-beta-D-Glcp 
D-arginine +  
D-argininium(1+) +  
D-aspartate(1-) +  
D-aspartic acid +  
D-erythrose 4-phosphate  
D-erythrose 4-phosphate(2-) 
D-fructose 6-phosphate(2-) 
D-galactonate +  
D-galactono-1,4-lactone +  
D-galactopyranose +   
D-galactopyranose 1-phosphate +   
D-galactosamine +   
D-galactose +   
D-galactosyl-N-hexadecanoylsphinganine 
D-galactosyl-N-tetracosanoylsphinganine 
D-glucarate(2-) +  
D-glucitol +   
D-glucitol 6-phosphate 
D-gluconate +  
D-glucono-1,5-lactone +  
D-glucopyranose +   
D-glucopyranose 6-phosphate(2-) +  
D-glucopyranuronate +  
D-glucosamine +   
D-glucosamine 6-phosphate +   
D-glucosaminide +  
D-glucosyl-N-acylsphingosine +  
D-glucosyl-N-tetracosanoylsphinganine 
D-glucuronate +  
D-glucuronate 1-phosphate 
D-glucurono-6,3-lactone  
D-glutamic acid +  
D-glutamine +  
D-glyceraldehyde +   
D-glyceraldehyde 3-phosphate 
D-kynurenine 
D-mannitol +   
D-mannitol 1-phosphate 
D-mannose 1-phosphate +  
D-o-tyrosine +  
D-ornithine +  
D-ornithinium(1+) 
D-pipecolate 
D-pipecolic acid 
D-prolinate 
D-proline +  
D-prolinium +  
D-prolinol 
D-ribose +   
D-ribosylnicotinate 
D-ribosylnicotinic acid +  
D-ribulose +  
D-ribulose 5-phosphate 
D-ribulose 5-phosphate(2-) 
D-serine +  
D-tagatofuranose 1,6-bisphosphate(4-) 
D-tagatofuranose 6-phosphate(2-) 
D-threitol  
D-xylono-1,4-lactone +  
D-xylulose +   
D-xylulose 5-phosphate  
D-xylulose 5-phosphate(2-) +  
dADP +  
dADP(3-) 
dATP 
dATP(4-) 
dCDP 
dCDP(3-) 
dCTP +   
deacetyllaurenobiolide 
deamido-NAD(+) +   
debrisoquin +   
decane-1,2-diol 
decanoate +  
decanoic acid +   
decanoyl-[acyl-carrier protein] 
decanoyl-CoA +   
decanoyl-CoA(4-) +  
decarboxysuprofen 
decarboxytiaprofenic acid 
dehydroabietic acid 
dehydroascorbic acid +   
dehydroascorbide(1-) 
dehydroepiandrosterone +   
dehydroepiandrosterone sulfate  
dehydroepiandrosterone sulfate(1-) +  
Delta(9)-tetrahydrocannabinol +   
deoxycholate +  
deoxycholoyl-CoA(4-) 
deoxyhemoglobin 
deoxyhypusine +  
deoxyribonucleic acid +  
desmosterol +   
dGDP(3-) 
dGTP  
diacylglycerol 28:2 
diacylglycerol 40:4 +  
dibenzo[a,l]pyrene  
dibenzothiazol-2-yl disulfide  
dichloroacetyl chloride 
dicyclohexylmethane-4,4'-diisocyanate  
diethyl hydrogen phosphate 
Dig-Cy5 
diglyceride +   
digoxigenin +   
digoxin +   
dihomolinoleate 
dihomolinoleic acid +  
dihydroferulate 
dihydroferulic acid +  
dihydrofolate(2-) 
dihydrofolic acid  
dihydrogen +   
dihydrolipoamide +   
dihydrolipoate +  
dihydrolipoic acid +   
dihydrolipoylprotein 
dihydroxyacetone +   
dihydroxyacetone phosphate  
diisocyanate +   
dioxygen +   
diphenylcyclopropenone  
diphenylmethane monoisocyanate 
diphenylmethane-4,4'-diisocyanate  
diphosphate(3-) +  
disodium cytidine 5'-monophosphate 
disodium maleate 
Disperse Blue 124 
Disperse Red 1 
dithioglycerophosphocholine +  
dITP 
dITP(4-) 
Dnp-Asn-Gln 
Dnp-Gln 
Dnp-Nor-Gln 
Dnp-Sar-Gln 
Dnp-Thr-Gln 
Dnp-Trp-Gln 
docosahexaenoic acid +   
dodecamethylpentasiloxane 
dodecanedioate(2-) 
dodecanedioic acid +   
dodecylphosphocholine 
dolichol +  
dolichyl beta-D-glucosyl phosphate 
dolichyl D-mannosyl phosphate +  
dolichyl diphosphate 
dolichyl phosphate +  
dolichyl phosphate(2-) 
domoic acid  
dopa +   
dopamine +   
dopaminium(1+) 
drug allergen +   
dT4 
dT6 
dT8 
dTDP +   
dTDP(3-) 
dTDP-4-dehydro-6-deoxy-alpha-D-glucose 
dTDP-4-dehydro-6-deoxy-alpha-D-glucose(2-) 
dTDP-4-dehydro-6-deoxy-L-mannose(2-) 
dTDP-alpha-D-glucose +  
dTDP-alpha-D-glucose(2-) +  
dTDP-D-glucuronate 
dTDP-L-rhamnose +  
dTMP(2-) +  
dTT(6-4)TT 
dTTP +  
dTTP(4-) 
dUDP 
dUDP(3-) 
dUMP +   
dUMP(2-) +  
dUTP +  
dyspropterin +  
ecgonine +   
ecgonine benzoate  
ecgonine methyl ester +   
ecgoninium methyl ester(1+) 
ecothiopate +   
egonol beta-D-glucoside 
elaidylphosphocholine 
ENPAVHFFKNIVTPRTP 
ENPVVAFFKNIVTPRTP 
ENPVVHFFFNIVTPRTP 
ENPVVHFFKNIVTPRTP 
ENPVVHFFYNIVTPRTP 
epiandrosterone +  
epiandrosterone sulfate 
epiandrosterone sulfate(1-) 
epidihydrocholesterin 
epimelibiose 
epitestosterone +   
ergosta-5,7,24(28)-trien-3beta-ol 
erythritol +  
erythro-4-hydroxy-L-glutamate(1-) 
erythro-5-hydroxy-L-lysine 
erythro-5-hydroxy-L-lysinium(1+) 
erythronate +  
erythronic acid +  
estetrol 
estra-1(10),4-diene-2,3,17-trione 
estra-1,5(10)-diene-3,4,17-trione 
estradiol +   
estriol +   
estriol 3-O-(beta-D-glucuronide)  
estrone +   
estrone 3-O-(beta-D-glucuronide)  
estrone 3-sulfate  
estrone 3-sulfate(1-) 
ethanol +   
ethanolamine +   
ethanolaminium(1+) +  
ethoxide +  
ethyl dihydrogen phosphate +   
ethyl hydrogen phosphate(1-) 
ethyl isothiocyanate 
ethyl linolenate 
ethyl phenylglyoxylate 
ethyl phosphate(2-) 
ethylamine +   
ethylene glycol +   
ethylene glycol dimethacrylate  
ethylenediamine dihydrochloride 
ethylmalonic acid +   
eugenol +   
FAD  
FADH2 +  
FADH2(2-) +  
ferredoxin +  
ferricytochrome b5 
ferricytochrome c +  
ferrocytochrome b5 
ferrocytochrome c +  
ferroheme a 
ferroheme b +   
fluazinam  
flucofuron 
fluorescein isothiocyanate +   
fluorescein-DNP hapten 
fMet-tRNA(fMet) 
FMN +   
FMN(3-) +  
folic acid +   
formaldehyde +   
formate +  
formyl-5-hydroxykynurenamine 
formyl-CoA(4-) 
framycetin +   
fructosylglycine 
fumarate(2-) +  
galactan +   
galactarate(1-) 
galactarate(2-) 
galactaric acid +   
galactitol +  
galactonic acid +  
galactosylceramide sulfate +  
gamma-aminobutyrate +   
gamma-aminobutyric acid +   
gamma-CEHC beta-glucuronide 
gamma-Glu-Gln 
gamma-Glu-Gln(1-) 
gamma-Glu-Glu 
gamma-Glu-Glu(2-) 
gamma-Glu-Gly 
gamma-Glu-Ile 
gamma-Glu-Leu 
gamma-Glu-Met 
gamma-Glu-Met(1-) 
gamma-Glu-Thr 
gamma-Glu-Thr(1-) 
gamma-Glu-Tyr 
gamma-Glu-Tyr(1-) 
gamma-Glu-Val 
gamma-Glu-Val(1-) 
gamma-glutamyl-beta-aminopropiononitrile 
gamma-glutamyl-beta-cyanoalanine 
gamma-glutamylphenylalanine 
gamma-glutamylthreonine 
gamma-linolenate +  
gamma-linolenic acid +   
gamma-linolenoyl-CoA 
gamma-linolenoyl-CoA(4-) 
GDP +   
GDP(3-) +  
GDP-4-dehydro-6-deoxy-alpha-D-mannose 
GDP-4-dehydro-6-deoxy-alpha-D-mannose(2-) 
GDP-alpha-D-mannose +  
GDP-alpha-D-mannose(2-) 
GDP-beta-L-fucose 
GDP-glucose +   
GDP-L-fucose(2-) 
geraniol +   
geranyl diphosphate  
geranyl diphosphate(3-) 
geranyl phosphate 
ghrelin 
gibberellin A1(1-) 
gibberellin A20 +  
gibberellin A3 +  
gibberellin A5 
gibberellin A7 
gibberellin A9 +  
Gln-tRNA(Gln) 
Glu-tRNA(Gln) 
Glu-tRNA(Glu) 
glucarate(2-) +  
glucaric acid +   
glucuronic acid +   
glutaconate(2-) +  
glutaconic acid +  
glutarate(1-) +  
glutarate(2-) +  
glutaric acid +   
glutaryl-CoA +   
glutaryl-CoA(5-) 
glutathionate(1-) +  
glutathione +   
glutathione disulfide  
glutathione disulfide(2-) 
glutaurine 
Gly-Phe zwitterion 
Gly-tRNA(Gly) 
Gly-Val 
glycan G00008 
glycan G10595 
glycan G10599 
glyceraldehyde 3-phosphate +   
glyceraldehyde 3-phosphate(2-) 
glycerate +  
glycerol +   
glycerol 1-phosphate +   
glycerone phosphate(2-) 
glycerophosphocholine +   
glycochenodeoxycholate +  
glycochenodeoxycholic acid +   
glycocholate +  
glycocholic acid  
glycodeoxycholate +  
glycodeoxycholic acid +   
glycohyocholate 
glycohyocholic acid 
glycolaldehyde +   
glycolate +  
glycolithocholate 
glycylglycine 
glycylglycine zwitterion 
glyoxal +   
glyoxal-lysine dimer 
glyoxylate +  
glyoxylic acid +   
gondoate 
GTP +   
GTP(4-) +  
guaiacyl lignin +  
guanidinoacetic acid 
guanine +   
guanosine 3',5'-bis(diphosphate) 
guanosine 3'-diphosphate 5'-triphosphate 
guanosine 5'-monophosphate +   
guanosine 5'-monophosphate(2-) +  
hapten GNL 
hapten OTAb 
hapten OTAd 
hapten OTAe 
hapten OTAf 
heme o +  
heparan sulfate  
heparan sulfate alpha-D-glucosaminide 
heparan sulfate alpha-D-glucosaminide 3-sulfate 
heparin glucosamine 3-O-sulfate 
heparosan N-sulfate L-iduronic acid 
heparosan-N-sulfate D-glucuronic acid 
heptan-2-one  
hexadecan-1-ol +  
hexadecanal +  
hexadecanedioate(2-) 
hexadecanedioic acid +  
hexadecanoate +   
hexadecasphing-4-enine +  
hexadecasphing-4-enine-1-phosphate 
hexahydrophthalic anhydride 
hexamethylene diisocyanate  
hexanoate +   
hexanoic acid +   
hexanoyl-CoA +   
hexyl isocyanate 
His-tRNA(His) 
histamine +   
histaminium 
HMBOA beta-D-glucoside 
holo-[acyl-carrier protein] 
homocysteine zwitterion 
homocystine +  
homocystine zwitterion +  
homogentisate 
homogentisic acid 
homovanillate 
homovanillic acid +   
hordenine 
HS44 
human blood serum metabolite +   
human urinary metabolite +   
human xenobiotic metabolite +   
hyaluronic acid  
hydantoin-5-propionate 
hydantoin-5-propionic acid 
hydrogen bromide +  
hydrogen chloride +   
hydrogen cyanide +   
hydrogen iodide +  
hydrogen peroxide +   
hydrogencarbonate +   
hydrogensulfite +   
hydroquinone +   
hydrosulfide +  
hydroxide +  
hydroxidodioxidosulfidosulfate(1-) 
hydroxy(phenyl)2-thienylacetic acid 
hydroxyacetone +  
hydroxycitronellal  
hyocholate 
hyocholic acid +  
hyodeoxycholate 
hyodeoxycholic acid +   
hypochlorous acid +   
hypotaurine +   
hypothiocyanous acid 
icosanoate +  
icosanoyl-CoA +  
icosatetraenoic acid +   
IDP(3-) 
iduronic acid +  
Ile(5)-angiotensin II  
Ile(5)-angiotensin II dizwitterion 
Ile-Ile 
Ile-tRNA(Ile) 
imidazol-4-ylacetate 
imidazol-4-ylacetic acid 
imidazole-4-acetaldehyde 
IMP +   
IMP(2-) 
indol-3-ylacetaldehyde  
indole +   
indole-3-acetate 
indole-3-acetic acid +   
indole-3-carboxylic acid +   
indole-5,6-quinone 
indoxyl sulfate  
inosine +   
insulin (human) 
iodide +   
iodine atom +   
iron(2+) +   
iron(3+) +   
isethionic acid  
isobutyrate +  
isobutyric acid anhydride 
isobutyryl-CoA +   
isobutyryl-CoA(4-) 
isocaproic acid +   
isocitrate(3-) +  
isoeugenol +   
isolithocholic acid 
isomaltose +  
isonicotinic acid +   
isopentenyl diphosphate  
isopentenyl diphosphate(3-) 
isopropyl palmitate  
isoursodeoxycholic acid 
isovaleryl-CoA 
isovaleryl-CoA(4-) +  
itaconate(2-) 
itaconic acid +  
itaconyl-CoA 
itaconyl-CoA(5-) 
ITP +  
ITP(3-) 
keto mycolic acid 
keto-phenylpyruvate 
kisspeptin-54 
kynurenate 
kynurenic acid +   
kynurenine +  
L-2-amino-3-oxobutanoic acid 
L-2-aminoadipate(1-) 
L-2-aminoadipic acid +  
L-4-hydroxyglutamic semialdehyde 
L-adenosylselenomethionine 
L-alloisoleucine +  
L-allysine +  
L-alpha-amino acid +   
L-alpha-aminobutyric acid +  
L-arabinitol +  
L-arabinopyranose +  
L-arabinose +  
L-arginine +   
L-argininium(1+) +  
L-ascorbate +  
L-asparagine +   
L-aspartate(1-) +  
L-aspartic acid +   
L-citrulline +  
L-citrulline zwitterion +  
L-cystathionine  
L-cysteate(1-) +  
L-cysteic acid 
L-cysteine +   
L-cysteine glutathione disulfide 
L-cysteine hydrochloride +  
L-cysteine hydrochloride hydrate 
L-cysteinylglycine +  
L-cysteinylglycine zwitterion 
L-cystine +   
L-cystine anion 
L-dehydroascorbic acid  
L-dopa +  
L-dopa(1-) +  
L-dopachromate 
L-dopachrome 
L-dopaquinone 
L-erythrulose +  
L-fucopyranose +  
L-fucopyranose 1-phosphate +  
L-fucose +  
L-fuculose +  
L-galactonate +  
L-gamma-glutamyl phosphate +  
L-gamma-glutamyl phosphate(2-) 
L-gamma-glutamyl-L-cysteinate(1-) 
L-gamma-glutamyl-L-cysteine  
L-glutamate(1-) +  
L-glutamic 5-semialdehyde +  
L-glutamic acid +   
L-glutamine +  
L-glycero-alpha-D-manno-Hepp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->3)-L-glycero-alpha-D-manno-Hepp-(1->5)-alpha-Kdo 
L-gulonate +  
L-gulono-1,4-lactone 
L-histidine +   
L-histidinol +  
L-homoarginine 
L-homocarnosine 
L-homocitrulline +  
L-homocitrulline zwitterion 
L-homocysteine +  
L-homocysteine thiolactone 
L-homoserine +  
L-iditol 
L-idopyranose 6-monomycolate 
L-isoleucine +  
L-kynureninate 
L-kynurenine +  
L-leucine +   
L-lysine +   
L-lysine zwitterion 
L-methionine +   
L-o-tyrosine +  
L-ornithinate +  
L-ornithine +   
L-ornithinium(2+) 
L-phenylalanine +   
L-pipecolate 
L-pipecolic acid +  
L-prolinate +  
L-proline +   
L-prolinium +  
L-saccharopinate(1-) 
L-saccharopine 
L-selenocysteine +   
L-serine +   
L-sorbose +  
L-Thr-(N->6)-alpha-D-Galp6d3OAc-(1->3)-beta-D-GalpNAc 
L-threonate 
L-threonine +  
L-thyroxine +  
L-tryptophan +   
L-tryptophanamide 
L-valine +   
L-xylonate 
L-xylulose +  
lactaldehyde +  
lactate +  
lactose +   
lactose 6'-phosphate 
lamivudine  
lanost-8-ene-3beta,30-diol  
lanosterol +   
laurenobiolide +  
lauroyl-CoA +   
lauroyl-CoA(4-) +  
Leu-Leu 
Leu-tRNA(Leu) 
leucomethylene blue 
leukotriene A4 +   
leukotriene A4(1-) 
leukotriene B4 +   
leukotriene B4(1-) 
leukotriene C3 
leukotriene C4 +   
leukotriene C4(2-) 
leukotriene D3 
leukotriene D4  
leukotriene E4(1-) 
leukotriene F4 
levoglucosan 
limonene +   
linalool 6-hydroperoxide 
linalool 7-hydroperoxide 
linalool hydroperoxide +  
linoleamide  
linoleoyl-CoA 
lipid II 
lipoamide +   
lipoate +  
lipoxin A4 +   
lipoxin B4 +  
lipoyl-AMP +  
lipoyl-AMP(1-) +  
lipoylprotein 
lissamine fast yellow 
lissamine fast yellow (acid form) 
lithocholate +  
lithocholic acid +   
lithocholyl-CoA 
litreol  
loracarbef anion 
lugdunin 
Lys-GalA 
Lys-Thr-Trp-Gly-Lys-Asn-Leu-Val-Phe 
Lys-tRNA(Lys) 
lysophosphatidylcholine +   
lysophosphatidylcholine 20:2 +  
lysophosphatidylcholine 20:5 +  
lysophosphatidylcholine 22:4 +  
lysophosphatidylcholine(0:0/16:0) +  
lysophosphatidylcholine(0:0/16:1) +  
lysophosphatidylcholine(0:0/18:0) +  
lysophosphatidylcholine(0:0/18:2) +  
lysophosphatidylcholine(0:0/20:4) +  
lysophosphatidylcholine(0:0/20:5) 
lysophosphatidylcholine(16:1/0:0) +  
lysophosphatidylcholine(18:0/0:0) 
lysophosphatidylcholine(18:2/0:0) +  
lysophosphatidylcholine(20:4/0:0) +  
lysophosphatidylethanolamine 16:0 +  
lysophosphatidylethanolamine 18:2 +  
m-tyraminium 
maleic acid +   
maleic anhydride 
malonate(2-) +  
malonic acid +   
malonyl-CoA  
malonyl-CoA(5-) 
maltose +   
mannarate(2-) +  
mannaric acid +  
mannitol +   
melatonin +   
melibiitol 
melibiose +   
menatetrenone +   
mesaconate(2-) 
mesaconic acid +  
mesaconyl-CoA 
meso-2,6-diaminopimelic acid +  
meso-2,6-diaminopimelic acid dizwitterion 
Met-tRNA(Met) 
metal allergen +   
metal cation allergen +   
methacholine +   
methacrylyl-CoA  
methanethiol +   
methanol +   
methionine S-oxide +  
methoxide 
methoxy mycolic acid 
methyl 4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-2-O-methyl-alpha-D-mannopyranoside 
methyl dihydrogen phosphate  
methyl group 
methyl icosapentaenoate 
methyl isocyanate +   
methyl methacrylate  
methyl nonanoate 
methyl phenylglyoxalate 
methyl phosphate(2-) 
methyl propenyl ketone 
methylamine +   
methylammonium +  
methylcobalamin  
methylene group 
methylglyoxal +   
methylglyoxal-lysine dimer 
methylhexahydrophthalic anhydride 
methylmalonate(1-) 
methylmalonate(2-) 
methylmalonic acid +   
methylmalonyl-CoA +  
methylsuccinic acid 
methyltetrahydrophthalic anhydride 
miltefosine  
mono(glucosyluronic acid)bilirubin(2-) 
monoacylglycerol 14:0 +  
monoacylglycerol 16:0 +  
monoacylglycerol 16:1 +  
monoacylglycerol 18:0 +  
monoacylglycerol 18:1 +   
monoacylglycerol 18:2 +  
monoacylglycerol 18:3 +  
monoacylglycerol 20:5 +  
monoacylglycerol phosphate +   
monodehydro-L-ascorbate(1-) 
monodehydro-L-ascorbic acid 
monothioglycerophosphocholine +  
murideoxycholate 
murideoxycholic acid 
myo-inositol +   
myo-inositol 1,3,4,5,6-pentakisphosphate 
myo-inositol 1,3,4,5,6-pentakisphosphate(10-) 
myo-inositol 1,3,4,6-tetrakisphosphate 
myo-inositol 1,3,4,6-tetrakisphosphate(8-) 
myo-inositol 1,3-bisphosphate 
myo-inositol hexakisphosphate  
myo-inositol hexakisphosphate(12-) 
myristamide 
myristoyl-[acyl-carrier protein] 
myristoyl-CoA +   
myristoyl-CoA(4-) +  
N(1),N(12)-diacetylsperminium(2+) 
N(1)-(5-phospho-D-ribosyl)glycinamide 
N(1)-(5-phospho-D-ribosyl)glycinamide(1-) +  
N(1)-acetylspermidinium(2+) 
N(1)-acetylspermine 
N(1)-acetylsperminium(3+) 
N(1)-isopropyl-2-methylpropan-1,2-diamine 
N(2),N(2)-dimethylguanosine 
N(2)-(5'-phosphopyridoxyl)-L-lysine 
N(2)-acetyl-L-lysine 
N(2)-acetyl-L-lysine zwitterion 
N(2)-acetyl-L-ornithine 
N(2)-acetyl-L-ornithine zwitterion 
N(2)-formyl-N(1)-(5-phospho-D-ribosyl)glycinamide(2-) 
N(2)-methylguanine 
N(2)-phenylacetyl-L-glutaminate 
N(2)-phenylacetyl-L-glutamine 
N(2)-succinyl-L-glutamic acid 
N(4)-[alpha-L-fucosyl-(1->3)-N-acetyl-4-O-glycosyl-D-glucosaminyl]-L-asparagine residue 
N(4)-\{beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->3)-[alpha-D-Man-(1->6)]-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc\}-Asn residue 
N(4)-\{beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc\}-Asn residue 
N(4)-\{N-acetyl-beta-D-glucosaminyl-(1->2)-alpha-D-mannosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->2)-alpha-D-mannosyl-(1->6)]-beta-D-mannosyl-(1->4)-N-acetyl-beta-D-glucosaminyl-(1->4)-[alpha-L-fucosyl-(1->6)]-N-acetyl-beta-D-glucosaminyl\}-L-asparagine 
N(5)-[(Z)-amino(hydroxyimino)methyl]ornithine +  
N(6),N(6),N(6)-trimethyl-L-lysine +  
N(6)-(1,2-dicarboxylatoethyl)-AMP(4-) 
N(6)-acetyl-L-lysine +  
N(6)-acetyl-N(2)-(5'-phosphonatopyridoxyl)-L-lysinate(2-) 
N(6)-acetyl-N(2)-(5'-phosphopyridoxyl)-L-lysine 
N(6)-dansyl-L-lysine 
N(6)-Dnp-Lys-NH2 
N(8)-acetylspermidine 
N(8)-acetylspermidinium(2+) 
N(alpha)-acetyl-L-arginine +  
N(pros)-methyl-L-histidine +  
N(tele)-methyl-L-histidine +  
N(tele)-methylhistamine  
N(tele)-methylhistaminium 
N,N'-diacetylchitobiose +  
N,N'-diacetylchitobiosyldiphosphodolichol 
N,N'-dibutylthiourea 
N,N'-diethylthiourea 
N,N'-diphenylthiourea  
N,N-dimethylacetamide 
N,N-dimethylethanolamine phosphate 
N,N-dimethylglycine 
N,O-(Dnp)2-Tyr-Gln 
N,S-isopropylidene-D-penicillamine 
N-(11Z-icosenoyl)-sphingosine-1-phosphocholine 
N-(15Z)-tetracosenoylsphingosine 
N-(17Z-hexacosenoyl)-sphingosine-1-phosphocholine 
N-(17Z-hexacosenoyl)sphingosine 
N-(2-furoyl)glycinate 
N-(2-furoyl)glycine 
N-(2-methylbutanoyl)glycine 
N-(4-aminobutyl)dabigatranamide 
N-(5'-phosphonatopyridoxyl)-D-alaninate(2-) 
N-(5'-phosphonatopyridoxyl)-L-alaninate(2-) 
N-(5'-phosphopyridoxyl)-D-alanine 
N-(5'-phosphopyridoxyl)-L-alanine 
N-(9Z-hexadecenoyl)sphingosine-1-phosphocholine 
N-(hexadecanoyl)-beta-D-galactosylsphingosine 
N-(p-hydroxyphenyl)glycine 
N-(p-nitrophenylphosphobutanoyl)glycine 
N-(trans-4'-nitro-4-stilbenyl)-N-methyl-5-aminopentanoic acid 
N-2-hydroxypalmitoylsphingosine 
N-[(10-methyl-9,10-dihydroacridin-9-yl)carbonyl]-beta-alanine 
N-[(11Z)-octadecenoyl]sphinganine-1-phosphocholine 
N-[(13Z)-docosenoyl]sphing-4-enine-1-phosphocholine 
N-[(13Z)-docosenoyl]sphingosine 
N-[(15Z)-tetracosenoyl]sphing-4-enine-1-phosphocholine 
N-[(15Z)-tetracosenoyl]sphinganine 
N-[(15Z)-tetracosenoyl]sphingosine 1-phosphate 
N-[(17Z)-hexacosenoyl]sphinganine 
N-[(9-beta-D-ribofuranosylpurin-6-yl)carbamoyl]threonate 
N-[(9-beta-D-ribofuranosylpurin-6-yl)carbamoyl]threonine 
N-[(9Z)-hexadecenoyl]glycine 
N-[(9Z)-octadecenoyl]sphinganine 
N-[(E)-4-ammoniobutylidene]propane-1,3-diaminium 
N-[(R)-4-phosphonatopantothenoyl]-L-cysteinate(3-) 
N-[(R)-4-phosphopantothenoyl]-L-cysteine 
N-[(R)-pantothenoyl]-L-cysteinate 
N-[(R)-pantothenoyl]-L-cysteine +  
N-[12(S)-hydroperoxy-(5Z,8Z,10E,14Z)-icosatetraenoyl]taurine 
N-[15(S)-hydroperoxy-(5Z,8Z,11Z,13E)-icosatetraenoyl]taurine 
N-[4-(4-nitrophenylphospho)butanoyl]-D-alanine 
N-[4-(4-nitrophenylphospho)butanoyl]-L-alanine 
N-\{alpha-Glc-(1->2)-alpha-Glc-(1->3)-alpha-Glc-(1->3)-alpha-Man-(1->2)-alpha-Man-(1->2)-alpha-Man-(1->3)-[alpha-Man-(1->2)-alpha-Man-(1->3)-[alpha-Man-(1->2)-alpha-Man-(1->6)]-alpha-Man-(1->6)]-beta-Man-(1->4)-beta-GlcNAc-(1->4)-beta-GlcNAc\}-L-Asn residue 
N-\{alpha-Glc-(1->3)-alpha-Glc-(1->3)-alpha-Man-(1->2)-alpha-Man-(1->2)-alpha-Man-(1->3)-[alpha-Man-(1->2)-alpha-Man-(1->3)-[alpha-Man-(1->2)-alpha-Man-(1->6)]-alpha-Man-(1->6)]-beta-Man-(1->4)-beta-GlcNAc-(1->4)-beta-GlcNAc\}-L-Asn residue 
N-\{alpha-Glc-(1->3)-alpha-Man-(1->2)-alpha-Man-(1->2)-alpha-Man-(1->3)-[alpha-Man-(1->2)-alpha-Man-(1->3)-[alpha-Man-(1->2)-alpha-Man-(1->6)]-alpha-Man-(1->6)]-beta-Man-(1->4)-beta-GlcNAc-(1->4)-beta-GlcNAc\}-L-Asn residue 
N-\{alpha-Man-(1->3)-[alpha-Man-(1->3)-[alpha-Man-(1->6)]-alpha-Man-(1->6)]-beta-Man-(1->4)-beta-GlcNAc-(1->4)-beta-GlcNac\}-L-Asn residue 
N-\{beta-D-Man-(1->2)-beta-D-Man-(1->2)-beta-D-ManO[CH2]3S[CH2]2NHC(O)[CH2O]4C(O)[CH2]2S[CH2]2C(O)\}-YGKDVKDLFDYAQE-NH-[CH2O]3[CH2]2C(O)NHC(CO2H)[CH2]4N3 +  
N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 
N-acetyl-alpha-D-galactosamine +  
N-acetyl-alpha-D-galactosaminyl group +  
N-acetyl-alpha-D-galactosaminyl-(1->3)-[alpha-L-fucosyl-(1->2)]-beta-D-galactose derivative 
N-acetyl-alpha-D-galactosaminyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->3)-alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide +  
N-acetyl-alpha-D-galactosaminyl-L-serine residue 
N-acetyl-alpha-D-glucosamine 1-phosphate 
N-acetyl-alpha-D-muramoyl-L-alanine 
N-acetyl-alpha-neuraminic acid +  
N-acetyl-alpha-neuraminosyl-(2->3)-beta-D-galactosylceramide 
N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucose +  
N-acetyl-alpha-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosamine 
N-acetyl-beta-D-galactosamine +  
N-acetyl-beta-D-galactosaminyl-(1->3)-alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide +  
N-acetyl-beta-D-galactosaminyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide +  
N-acetyl-beta-D-galactosaminyl-(1->4)-N-acetyl-beta-D-glucosaminyl group 
N-acetyl-beta-D-glucosamine +   
N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide(d18:1(4E)) +  
N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide +  
N-acetyl-beta-D-glucosaminyl-(1->3)-N-acetyl-D-galactosaminyl group +  
N-acetyl-beta-D-glucosaminyl-(1->4)-N-acetyl-beta-D-glucosamine +  
N-acetyl-beta-D-glucosaminyl-1,6-(N-acetyl-beta-D-glucosaminyl-1,3)-N-acetyl-D-galactosaminyl group 
N-acetyl-beta-neuraminic acid +   
N-acetyl-beta-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosamine 
N-acetyl-D-galactosamine +  
N-acetyl-D-galactosamine 1-phosphate +  
N-acetyl-D-galactosamine-6-phosphocholine 
N-acetyl-D-glucosamine 6-phosphate +  
N-acetyl-D-glucosamine 6-phosphate(2-) +  
N-acetyl-D-glucosaminide +  
N-acetyl-D-glucosaminyldiphosphodolichol 
N-acetyl-D-mannosamine 6-phosphate(2-) 
N-acetyl-L-2-aminoadipic acid 
N-acetyl-L-alanine +  
N-acetyl-L-aspartate(2-) +  
N-acetyl-L-aspartic acid +   
N-acetyl-L-cysteinate 
N-acetyl-L-cysteine +   
N-acetyl-L-gamma-glutamyl phosphate(3-) 
N-acetyl-L-glutamate(2-) +  
N-acetyl-L-glutamic acid 
N-acetyl-L-glutamine 
N-acetyl-L-isoleucinate 
N-acetyl-L-serine +  
N-acetylcadaverine 
N-acetylgalactosamine +  
N-acetylglycinate +   
N-acetylglycine +  
N-acetylhistamine 
N-acetylisoleucine +  
N-acetylneuraminate +  
N-acetylneuraminic acid +   
N-acetylneuraminic acid 9-phosphate 
N-acetylneuraminyl group 
N-acetylneuraminyl-(2->8)-N-acetylneuraminyl-(2->8)-N-acetylneuraminyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-N-acylsphingosine +  
N-acetylputrescine 
N-acetylputrescinium 
N-acetylserotonin  
N-acyl-beta-D-galactosylsphingosine +  
N-acyl-D-mannosamine +  
N-acylphytosphingosine +   
N-acylsphinganine +   
N-acylsphingosine +   
N-acylsphingosine 1-phosphate +  
N-acylsphingosine 1-phosphate(2-) +  
N-acylsphingosine 1-phosphoethanolamine +  
N-arachidonoyl-2-oxoserotonin 
N-arachidonoylglycinate 
N-arachidonoylserotonin 
N-arachidonoyltaurine 
N-benzoylglycinate 
n-butyl isocyanate 
n-butyl oleate 
N-butylformamide 
N-carbamoyl-beta-alaninate 
N-carbamoyl-beta-alanine 
N-carbamoyl-L-aspartate(2-) 
N-carbamoylaspartic acid +  
N-carbamoylglutamic acid 
N-cyclohexylformamide 
N-cyclopropylammelide 
N-docosanoylsphinganine +  
N-docosanoylsphingosine 
N-docosanoylsphingosine-1-phosphocholine 
N-dodecanoyltaurine 
N-eicosanoylsphinganine +  
N-formimidoyl-L-glutamate(2-) +  
N-formyl-L-aspartic acid 
N-formyl-L-glutamic acid 
N-formyl-L-kynurenine +  
N-formylanthranilate 
N-glycoloyl-beta-D-glucosamine 
N-glycoloylneuraminate +  
N-heneicosanoylsphingosine-1-phosphocholine 
N-henicosanoylsphinganine-1-phosphocholine 
N-heptadecanoylsphinganine-1-phosphocholine 
N-heptadecanoylsphingosine-1-phosphocholine 
N-hexacosadienoylsphingosine-1-phosphocholine 
N-hexacosahexaenoylsphingosine 
N-hexacosanoylsphinganine-1-phosphocholine 
N-hexacosanoylsphingosine 
N-hexacosanoylsphingosine-1-phosphocholine 
N-hexadecanoyl-O-(1-octadecanoyl-2-oleoyl-sn-glycero-3-phospho)-L-serine 
N-hexadecanoylglycine +  
N-hexadecanoylsphinganine +  
N-hexadecanoylsphinganine-1-phosphocholine 
N-hexadecanoylsphingosine-1-phosphocholine 
N-hexadecanoyltaurine 
N-hydroxy-PhIP  
N-icosanoylsphingosine 
N-icosanoyltaurine 
N-isopropyl-N'-phenyl-p-phenylenediamine  
N-lignoceroylsphingosine-1-phosphocholine 
N-methyl-4-pyridone-3-carboxamide +  
N-methyl-6-pyridone-3-carboxamide +   
N-methylbutan-2-amine 
N-methylethanolaminium phosphate(1-) 
N-methylmesoporphyrin 
N-methylphenylethanolamine 
N-methylphenylethanolaminium 
N-methylproline 
N-methylproline zwitterion 
N-methylputrescine 
N-methylputrescinium(2+) 
N-methylserotonin 
N-methyltyramine +   
N-methyltyraminium 
N-myristoylsphingosine-1-phosphocholine 
N-nonadecanoylsphingosine-1-phosphocholine 
N-octadecanoylglycine 
N-octadecanoylsphingosine 
N-octanoylisoglobotriaosyl ceramide 
N-octodecanoylsphinganine +  
N-oleoyl-L-serine 
N-oleoylsphinganine-1-phosphocholine 
N-oleoylsphingosine 
N-oleoylsphingosine-1-phosphocholine 
N-oleoylthreonine 
N-pentadecanoylsphingosine-1-phosphocholine 
N-phenylglycine 
N-phosphocreatinate(2-) 
N-phosphocreatine 
N-propylbenzamide 
N-ribosylnicotinamide  
N-stearoylsphingosine-1-phosphocholine 
N-stearoyltaurine 
N-tetracosadienoylsphingosine-1-phosphocholine 
N-tetracosanoylsphinganine +  
N-tetracosanoylsphinganine-1-phosphocholine 
N-tetracosanoylsphingosine 
N-tetracosanoyltaurine 
N-tetradecanoyltaurine 
N-tetradecenoylsphingosine-1-phosphocholine 
N-tricosanoylsphing-4-enine-1-phosphocholine 
N-tricosanoylsphinganine-1-phosphocholine 
N-tricosanoylsphingosine 
N-tricosenoylsphing-4-enine-1-phosphocholine 
N-tridecanoylsphingosine-1-phosphocholine 
NAD(+)  
NAD(1-) +  
NADH(2-) +  
NADP(3-) 
NADPH(4-) +  
nandrolone +   
naphthalene +   
naphthalene-1,2-diol +   
neomycin sulfate 
neurotensin  
nickel atom +   
nickel dichloride +   
nickel sulfate +   
nicotinamide +   
nicotinate D-ribonucleotide(2-) 
nicotinic acid +   
nicotinic acid D-ribonucleotide +  
nifedipine  
ninhydrin 
nitric oxide  
nitrite +   
nitrososulfadiazine 
nitrososulfamethoxazole  
nitrososulfapyridine 
NMN zwitterion  
NMN(-) 
nociceptin  
nonanal  
nordazepam  
norlaudanosoline +   
nucleoside diphosphate +   
nucleoside triphosphate +   
O(4')-sulfo-L-tyrosinate(1-) 
O(4')-sulfo-L-tyrosine 
O(4)-methylthymine 
O,O-diethyl hydrogen thiophosphate 
O-(2-aminopropyl)-O'-(2-methyoxyethyl)octa(propylene glycol) 
O-(2-tetradecenoyl)carnitine 
O-(3-hydroxyvaleryl)-L-carnitine 
O-(4-trifluoroacetamidobenzylphosphonyl)chloramphenicol 
O-(dimethylnonenoyl)carnitine 
O-[(2E)-hexenedioyl]carnitine 
O-[(3R,11Z,14Z)-3-hydroxyicosadienoyl]carnitine 
O-[(5Z)-tetradecenoyl]-L-carnitine 
O-[(7Z,10Z,13Z,16Z,19Z)-docosapentaenoyl]carnitine 
O-[N-acetyl-alpha-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosaminyl]-L-serine residue 
O-acetyl-L-carnitine  
O-acetylcarnitine +   
O-acetyltropine 
O-benzoylecgonine 5-carboxypentyl ester 
O-butanoylcarnitine +   
O-decanoyl-L-carnitine 
O-dodecanoylcarnitine +  
O-glutaroyl-L-carnitine 
O-heptadecanoylcarnitine 
O-hexanoyl-L-carnitine 
O-hexanoylcarnitine +  
O-hydroxy(phenyl)phosphinoyl ecgonine methyl ester 
O-isobutyryl-L-carnitine 
O-isobutyrylcarnitine +  
O-isovalerylcarnitine +  
O-linoleyl-L-carnitine 
O-methylserotonin +   
O-octadecadiendioylcarnitine 
O-octadecanoyl-L-carnitine 
O-octanoyl-L-carnitine 
O-octenedioylcarnitine 
O-oleoylcarnitine 
O-palmitoyl-L-carnitine 
O-phospho-L-serine +  
O-phosphoethanolamine 
O-phosphonato-L-homoserine(2-) 
O-phosphonato-L-serine(2-) +  
O-phosphonatoethanaminium(1-) 
O-phosphonatooxy-D-serine(2-) 
O-phosphoserine +  
O-propanoylcarnitine +  
O-stearoylcarnitine 
O-succinylcarnitine 
O-tetradecanoyl-L-carnitine 
O-tiglylcarnitine +  
o-tyrosine 
O-undecenoylcarnitine 
obtusifoliol 
octadecadienoate +  
octadecan-1-ol +   
octadecanoate +  
octadecanoic acid +   
octanoate +  
octanoic acid +   
octanoyl-[acyl-carrier protein] 
octanoyl-CoA +  
octanoyl-CoA(4-) +  
octulose 8-phosphate 
oleamide  
oleic acid +   
oleoyl-CoA  
oleoyl-CoA(4-) 
oleyl acetate 
omega-3 fatty acid +   
omega-hydroxymenaquinone-4 
omeprazole +   
ophthalmic acid 
oregon green 488 
organic halide 
ornidazole  
ornithine +   
ornithinium(1+) +  
orotate +  
orotic acid +   
orotidine 5'-phosphate 
orotidine 5'-phosphate(3-) 
oxalate(1-) +  
oxalate(2-) +  
oxalic acid +   
oxaloacetate(2-) 
oxidized adrenodoxin 
oxidized ferredoxin +  
oxidopamine  
oxirane +   
P(1),P(3)-bis(5'-adenosyl) triphosphate 
P(1),P(4)-bis(5'-adenosyl) tetraphosphate  
P(1),P(4)-bis(5'-adenosyl) tetraphosphate(4-) 
P(1),P(4)-bis(5'-guanosyl) tetraphosphate  
P(1),P(4)-bis(5'-xanthosyl) tetraphosphate 
P(1),P(4)-bis(uridin-5'-yl) tetraphosphate 
p-aminodiphenylamine +   
p-aminophenylphosphocholine 
p-cresol +   
p-cresol sulfate 
p-cresol sulfate(1-) 
p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 
p-nitrobenzyl glutaryl glycinic acid 
p-nitrophenylphosphocholine 
p-tolyl beta-D-glucuronide 
p-tolyl beta-D-glucuronide(1-) 
P. aeruginosa serotype O11 O-specific polysaccharide 
paclitaxel +   
palmitoleate +  
palmitoleoyl-CoA(4-) 
palmitoyl-[acyl-carrier protein] 
palmitoyl-CoA +   
palmitoyl-CoA(4-) 
pantetheine 
pantetheine 4'-phosphate(2-) +  
parabanic acid +  
paraoxon  
parathion  
patent blue V 
pelargonidin 3-O-sophoroside 
penicillin +   
penicillin allergen +   
penicilloyl group allergen +  
pentan-3-amine 
peptide allergen +  
peptide YY 
perillic acid +   
perillyl aldehyde  
perillyl-coenzyme A 
peroxynitrite 
Phe(4-NO2)-Gln 
Phe-tRNA(Phe) 
phenanthrene +   
phenanthrene-3,4-diol +  
phenol +   
phenolic phthiocerol +  
phenoxyacetic acid +   
phenyl [1-(N-succinylamino)pentyl]phosphonate 
phenyl isocyanate  
phenyl isothiocyanate 
phenyl phosphate 
phenylacetaldehyde +   
phenylacetate +  
phenylacetic acid +   
phenylacetyl-CoA +  
phenylacetyl-CoA(4-) 
phenylacetylglycine +   
phenylacetylglycine(1-) 
phenylethanolamine +  
phenylethanolaminium 
phosphate ion +  
phosphatidate(2-) +  
phosphatidic acid 18:3 
phosphatidyl-L-serine +  
phosphatidyl-N,N-dimethylethanolamine +  
phosphatidyl-N-methylethanolamine +  
phosphatidylcholine (16:0/20:5) 
phosphatidylcholine 10:0 
phosphatidylcholine 12:0 +  
phosphatidylcholine 13:0 +  
phosphatidylcholine 15:0 
phosphatidylcholine 15:1 
phosphatidylcholine 16:2 
phosphatidylcholine 18:0 
phosphatidylcholine 18:2 
phosphatidylcholine 18:3 
phosphatidylcholine 25:0 
phosphatidylcholine 29:1 +  
phosphatidylcholine 35:3 +  
phosphatidylcholine 35:4 +  
phosphatidylcholine 36:4 +   
phosphatidylcholine 42:7 
phosphatidylcholine O-13:0 
phosphatidylethanolamine 18:0 zwitterion 
phosphatidylethanolamine 18:1 zwitterion 
phosphatidylethanolamine 18:2 zwitterion 
phosphatidylethanolamine 19:1 
phosphatidylethanolamine 20:3 zwitterion 
phosphatidylethanolamine 20:4 zwitterion 
phosphatidylethanolamine 21:0 zwitterion 
phosphatidylethanolamine 22:4 zwitterion 
phosphatidylethanolamine 35:1 +  
phosphatidylethanolamine 36:2 +  
phosphatidylethanolamine 36:3 +  
phosphatidylethanolamine 37:2 
phosphatidylethanolamine 38:3 +  
phosphatidylethanolamine 38:4 +  
phosphatidylethanolamine O-16:0 zwitterion 
phosphatidylethanolamine P-16:0 
phosphatidylglycerol +   
phosphatidylglycerol(1-) +  
phosphatidylinositol 22:2(1-) 
phosphatidylserine 18:0 
phosphatidylserine 40:1 
phosphatidylserine 40:2 
phosphatidylserine 42:1 
phosphatidylserine(18:1/22:1) 
phosphocholine +   
The phosphate of choline; and the parent compound of the phosphocholine family.
phosphoenolpyruvate  
phosphonoacetaldehyde 
phosphoric acid +   
phthalaldehyde  
phthalic anhydride +   
phthalyl group 
phthiocerol A +  
phylloquinone +   
phytanate +  
phytanoyl-CoA(4-) 
phytosphingosine +   
picolinic acid +   
pinocarveol +  
pinocarvone 
pipecolate +  
piperidine +   
poly(N-acetyllactosamine)  
porphobilinogen  
porphobilinogen(1-) 
potassium dichromate  
potassium(1+) +   
pregnenolone +   
pregnenolone sulfate  
prenyl diphosphate  
prenyl diphosphate(3-) 
presqualene diphosphate 
presqualene diphosphate(3-) 
preuroporphyrinogen  
preuroporphyrinogen(8-) 
primin 
pristanal 
pristanic acid +  
pristanoyl-CoA +  
Pro-Hyp 
Pro-Hyp zwitterion 
Pro-tRNA(Pro) 
procollagen 5-hydroxy-L-lysine 
progesterone +   
proline +   
prop-2-ynal 
propane-1,2-diol +   
propanoyl-AMP 
propionate +   
propionyl-CoA +   
propionyl-CoA(4-) +  
propyl butyrate 
propyl propionate 
prostaglandin A1(1-) +  
prostaglandin A2 +   
prostaglandin B1  
prostaglandin B2 
prostaglandin C1(1-) 
prostaglandin C2 
prostaglandin D1 
prostaglandin D1(1-) 
prostaglandin D2 +   
prostaglandin D2 1-glyceryl ester 
prostaglandin D2(1-) 
prostaglandin D3  
prostaglandin E1 +   
prostaglandin E1(1-) +  
prostaglandin E2 +   
prostaglandin E2 1-glyceryl ester 
prostaglandin E2 2-glyceryl ester 
prostaglandin E2(1-) +  
prostaglandin E3  
prostaglandin F1alpha +   
prostaglandin F2alpha +   
prostaglandin F2alpha 1-glyceryl ester 
prostaglandin F2alpha 2-glyceryl ester 
prostaglandin F2alpha(1-) 
prostaglandin F2beta 
prostaglandin G1 
prostaglandin G1(1-) +  
prostaglandin G2 +   
prostaglandin G2 2-glyceryl ester 
prostaglandin H2 +   
prostaglandin H2 2-glyceryl ester 
prostaglandin H2(1-) 
prostaglandin H3 
prostaglandin I2 +   
prostaglandin I2 2-glyceryl ester 
prostaglandin I2(1-) +  
prostaglandin J2 +   
protein disulfide +  
protein dithiol +  
protirelin 
protoporphyrin +   
protoporphyrinate 
protoporphyrinogen  
protoporphyrinogen(2-) 
pseudotropine +  
psychosine +  
psychosine sulfate 
psychosine(1+) 
pyridine-2,5-diol 
pyridine-2-thiol 
pyridoxal +   
pyridoxal 5'-phosphate +   
pyridoxal 5'-phosphate(2-) 
pyridoxal hydrochloride 
pyridoxamine +   
pyridoxamine 5'-phosphate 
pyridoxamine 5'-phosphate(1-) 
pyridoxamine dihydrochloride 
pyridoxamine hydrochloride 
pyridoxaminium(1+) +  
pyridoxine +   
pyridoxine 5'-phosphate 
pyridoxine 5'-phosphate(2-) 
pyrimidine-2-thiol 
pyroglutamylglutaminate 
pyroglutamylglutamine 
pyrraline +  
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 
quaternium-15 
quinaldate 
quinaldic acid 
quinolinate(1-) +  
quinolinate(2-) 
quinoline-4,6-diol 
quinoline-4,8-diol 
quinolinic acid  
rac-1-monolinoleoylglycerol 
raffinose +   
raphanusamic acid 
Reactive Red 6 hapten copper complex 
reduced adrenodoxin 
reduced ferredoxin +  
resolvin D5 
resolvin T1 
resolvin T2 
resolvin T3 
resolvin T4 
retinal +   
retinoic acid +   
retinol +   
ribitol +   
riboflavin +   
ribothymidine +  
S(6)-acetyldihydrolipoamide +  
S(8)-(2-methylbutanoyl)dihydrolipoamide 
S(8)-(2-methylpropanoyl)dihydrolipoamide 
S(8)-(3-methylbutanoyl)dihydrolipoamide 
S(8)-aminomethyldihydrolipoylprotein 
S(8)-glutaryldihydrolipoamide 
S(8)-succinyldihydrolipoamide 
S-(2-succinyl)-L-cysteine 
S-(3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl)-4'-phosphopantetheine 
S-(chloromethyl)glutathione 
S-(hydroxymethyl)glutathione  
S-(hydroxymethyl)glutathione(1-) 
S-adenosyl-L-homocysteine  
S-adenosyl-L-methioninate  
S-adenosyl-L-methionine +   
S-adenosylmethioninamine 
S-adenosylmethioninaminium 
S-butyryl-4'-phosphopantetheine 
S-choloyl-4'-phosphopantetheine 
S-decanoyl-4'-phosphopantetheine 
S-dodecanoyl-4'-phosphopantetheine 
S-formylglutathionate(1-) 
S-formylglutathione 
S-hexadecanoyl-4'-phosphopantetheine 
S-hexanoyl-4'-phosphopantetheine 
S-methyl-5-thio-alpha-D-ribose 1-phosphate 
S-methyl-5-thio-alpha-D-ribose 1-phosphate(2-) 
S-methyl-5-thio-D-ribulose 1-phosphate(2-) 
S-octanoyl