Submit Data |  Help |  Video Tutorials |  News |  Publications |  FTP Download |  REST API |  Citing RGD |  Contact   

Ontology Browser

Term:
corticotropin-releasing hormone (ovine) (CHEBI:65307)
Annotations: Rat: (0) Mouse: (0) Human: (0) Chinchilla: (0) Bonobo: (0) Dog: (0) Squirrel: (0) Pig: (0)
Parent Terms Term With Siblings Child Terms
((13)C)carbon dioxide 
(11)C-choline chloride 
apraclonidine +  
Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 
bentiromide 
benzylpenicilloyl polylysine 
betazole +  
betazole dihydrochloride 
ceruletide +   
ceruletide diethylamine 
chlormerodrin +  
corticotropin  
corticotropin-releasing hormone (human) 
corticotropin-releasing hormone (ovine) 
A corticotropin-releasing hormone from sheep composed of Ser, Gln, Glu, Pro, Pro, Ile, Ser, Leu, Asp, Leu, Val, Phe, His, Leu, Leu, Arg, Glu, Val, Leu, Glu, Met, Thr, Lys, Ala, Asp, Gln, Leu, Ala, Gln, Gln, Ala, His, Ser, Asn, Arg, Lys, Leu, Leu, Asp, Ile and Ala-NH2 residues joined in sequence.
cosyntropin  
creatinine  
cyclopentolate +  
cyclopentolate hydrochloride +  
dermaseptin s3(1-16)-NH2 
desmopressin +   
desmopressin acetate (anhydrous) +  
diagnostic imaging agent +   
edrophonium +   
edrophonium chloride 
ergometrine +  
ergometrine maleate 
gastrin-14 
JNK inhibitor I 
kisspeptin-54 
lixisenatide 
mastoparan  
mastoparan-A 
mastoparan-AF 
mastoparan-B 
mastoparan-D 
mastoparan-M 
mastoparan-V 
melittin  
methacetin-(methoxy-(13)C) 
metyrapone  
omega-conotoxin GVIA  
peptide YY 
phenol red  
poly(vinylpyrrolidone) +   
polyanethol sulfonic acid macromolecule +  
polyanethol sulfonic acid polymer 
Pro-Hyp 
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 
sapropterin +   
sapropterin dihydrochloride 
sodium chromate  
sodium p-aminohippurate 
sodium polyanethol sulfonate macromolecule +  
sodium polyanethol sulfonate polymer 
tetragastrin 
tolonium chloride 

Synonyms
Exact Synonyms: L-seryl-L-glutaminyl-L-alpha-glutamyl-L-prolyl-L-prolyl-L-isoleucyl-L-seryl-L-leucyl-L-alpha-aspartyl-L-leucyl-L-valyl-L-phenylalanyl-L-histidyl-L-leucyl-L-leucyl-L-arginyl-L-alpha-glutamyl-L-valyl-L-leucyl-L-alpha-glutamyl-L-methionyl-L-threonyl-L-lysyl-L-alanyl-L-alpha-aspartyl-L-glutaminyl-L-leucyl-L-alanyl-L-glutaminyl-L-glutaminyl-L-alanyl-L-histidyl-L-seryl-L-asparaginyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-alpha-aspartyl-L-isoleucyl-L-alaninamide
Related Synonyms: Corticotropin-releasing factor (sheep hypothalamus) ;   Corticotropin-releasing factor (sheep) ;   Formula=C206H341N59O62S ;   InChI=1S/C206H341N59O62S/c1-31-106(23)161(200(323)226-108(25)164(215)287)261-194(317)143(88-158(285)286)254-185(308)133(78-100(11)12)247-183(306)131(76-98(7)8)245-173(296)118(47-37-39-68-208)232-171(294)119(48-40-69-222-205(216)217)234-190(313)140(85-152(214)274)252-195(318)144(92-267)257-189(312)138(83-114-89-220-94-224-114)242-166(289)110(27)228-170(293)121(52-59-148(210)270)235-174(297)122(53-60-149(211)271)230-165(288)109(26)229-180(303)129(74-96(3)4)244-177(300)124(55-62-151(213)273)237-191(314)141(86-156(281)282)243-167(290)111(28)227-169(292)117(46-36-38-67-207)240-202(325)163(112(29)269)263-179(302)127(66-73-328-30)239-175(298)125(56-63-153(275)276)238-182(305)135(80-102(15)16)255-198(321)159(104(19)20)259-178(301)126(57-64-154(277)278)236-172(295)120(49-41-70-223-206(218)219)233-181(304)130(75-97(5)6)246-184(307)132(77-99(9)10)248-188(311)139(84-115-90-221-95-225-115)251-187(310)137(82-113-44-34-33-35-45-113)256-199(322)160(105(21)22)260-193(316)136(81-103(17)18)249-192(315)142(87-157(283)284)253-186(309)134(79-101(13)14)250-196(319)145(93-268)258-201(324)162(107(24)32-2)262-197(320)146-50-42-71-264(146)204(327)147-51-43-72-265(147)203(326)128(58-65-155(279)280)241-176(299)123(54-61-150(212)272)231-168(291)116(209)91-266/h33-35,44-45,89-90,94-112,116-147,159-163,266-269H,31-32,36-43,46-88,91-93,207-209H2,1-30H3,(H2,210,270)(H2,211,271)(H2,212,272)(H2,213,273)(H2,214,274)(H2,215,287)(H,220,224)(H,221,225)(H,226,323)(H,227,292)(H,228,293)(H,229,303)(H,230,288)(H,231,291)(H,232,294)(H,233,304)(H,234,313)(H,235,297)(H,236,295)(H,237,314)(H,238,305)(H,239,298)(H,240,325)(H,241,299)(H,242,289)(H,243,290)(H,244,300)(H,245,296)(H,246,307)(H,247,306)(H,248,311)(H,249,315)(H,250,319)(H,251,310)(H,252,318)(H,253,309)(H,254,308)(H,255,321)(H,256,322)(H,257,312)(H,258,324)(H,259,301)(H,260,316)(H,261,317)(H,262,320)(H,263,302)(H,275,276)(H,277,278)(H,279,280)(H,281,282)(H,283,284)(H,285,286)(H4,216,217,222)(H4,218,219,223)/t106-,107-,108-,109-,110-,111-,112+,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,159-,160-,161-,162-,163-/m0/s1 ;   InChIKey=QMZRMXQCHRPRQD-SAWSQHHPSA-N ;   Ovine ACTH releasing factor ;   Ovine CRF 41 ;   Ovine CRH ;   Ovine corticotropin-releasing factor ;   SMILES=CC[C@H](C)[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CO)[C@@H](C)CC)C(C)C)C(C)C)[C@@H](C)O)C(=O)N[C@@H](C)C(N)=O ;   SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2 ;   Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Val-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2 ;   Sheep corticotropin-releasing factor (1-41) ;   sheep corticotropin-releasing hormone
Xrefs: CAS:79804-71-0 "ChemIDplus" ;   PMID:10910802 "Europe PMC" ;   PMID:11380490 "Europe PMC" ;   PMID:17572122 "Europe PMC" ;   PMID:1846869 "Europe PMC" ;   PMID:18728165 "Europe PMC" ;   PMID:19470618 "Europe PMC" ;   PMID:19625690 "Europe PMC" ;   PMID:21508126 "Europe PMC" ;   PMID:2543267 "Europe PMC" ;   PMID:2838538 "Europe PMC" ;   PMID:3022629 "Europe PMC" ;   PMID:3494446 "Europe PMC" ;   PMID:6267699 "Europe PMC" ;   PMID:8045962 "Europe PMC" ;   PMID:8288718 "Europe PMC" ;   PMID:8768876 "Europe PMC" ;   Wikipedia:Corticotropin-releasing_hormone

paths to the root

NHLBI Logo

RGD is funded by grant HL64541 from the National Heart, Lung, and Blood Institute on behalf of the NIH.