Exhibits phosphomevalonate kinase activity. Involved in isopentenyl diphosphate biosynthetic process, mevalonate pathway. Predicted to localize to the cytosol and peroxisome. Human ortholog(s) of this gene implicated in porokeratosis. Orthologous to human PMVK (phosphomevalonate kinase); PARTICIPATES IN alendronate pharmacodynamics pathway; cholesterol biosynthetic pathway; cholesterol ester storage disease pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1, 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PMVK mRNA
[Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of PMVK mRNA, [Diethylnitrosamine co-treated with Phenobarbital] results in increased methylation of PMVK promoter
[Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of PMVK mRNA, [Diethylnitrosamine co-treated with Phenobarbital] results in increased methylation of PMVK promoter
[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1, 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PMVK mRNA
[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1, 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PMVK mRNA
MAPLGASPRLVLLFSGKRKSGKDFVTERLQSRLGGNICAVLRLSGPLKEQYAREHGLDFQKLLD ASTYKETYRRDMICWGEEKRQADPGFFCRKIVEGVSQPIWLVSDTRRMSDIQWFQEAYGALTQT VRVVASEQSRQQRGWVFTRGVDDAESECGLDSFGDFDWVIENHGDEQCLEDQLENLLEFIHAKL QR
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Gene-Chemical Interaction Annotations
