![]() |

![]() |
Create Name: | |
Description: |
![]() |
Save what matters to you |
{{ loginError }} |
Sign in with your RGD account |
Create New Account | Recover Password |
Analyze GeneStrainQTL List |
![]() Gene Annotator (Functional Annotation) unavailable |
![]() Gene Annotator (Annotation Distribution) unavailable |
![]() Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable |
Gene Annotator (Functional Annotation) |
Gene Annotator (Annotation Distribution) |
Variant Visualizer (Genomic Variants) |
![]() InterViewer (Protein-Protein Interactions) unavailable |
![]() Gviewer (Genome Viewer) unavailable |
![]() Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable |
InterViewer (Protein-Protein Interactions) |
GViewer (Genome Viewer) |
Variant Visualizer (Damaging Variants) |
![]() Gene Annotator (Annotation Comparison) unavailable |
![]() OLGA (Gene List Generator) unavailable |
![]() |
Gene Annotator (Annotation Comparison) |
OLGA (Gene List Generator) |
Excel (Download) |
![]() MOET (Multi-Ontology Enrichement) unavailable |
![]() GOLF (Gene-Ortholog Location Finder) unavailable |
|
MOET (Multi-Ontology Enrichement) |
GOLF (Gene-Ortholog Location Finder) |
![]() Term | Qualifier | Evidence | With | Reference | Notes | Source | Original Reference(s) | 1-naphthyl isothiocyanate | increases expression | ISO | RGD:1565037 | 6480464 | 1-Naphthylisothiocyanate results in increased expression of SELENOM mRNA | CTD | PMID:25380136 | 17alpha-ethynylestradiol | multiple interactions | ISO | RGD:1622145 | 6480464 | [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SELENOM mRNA | CTD | PMID:17942748 | 17beta-estradiol | increases expression | EXP | | 6480464 | Estradiol results in increased expression of SELENOM mRNA | CTD | PMID:20106945 | 17beta-estradiol | multiple interactions | EXP | | 6480464 | [Estradiol co-treated with TGFB1 protein] results in increased expression of SELENOM mRNA | CTD | PMID:30165855 | 17beta-estradiol | decreases expression | EXP | | 6480464 | Estradiol results in decreased expression of SELENOM mRNA | CTD | PMID:23019147 | 2,2',5,5'-tetrachlorobiphenyl | increases expression | ISO | RGD:1565037 | 6480464 | 2 more ... | CTD | PMID:23829299 | 2,3,7,8-tetrachlorodibenzodioxine | affects expression | ISO | RGD:1622145 | 6480464 | Tetrachlorodibenzodioxin affects the expression of SELENOM mRNA | CTD | PMID:21570461, PMID:24680724 | 2,3,7,8-tetrachlorodibenzodioxine | multiple interactions | ISO | RGD:1622145 | 6480464 | [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SELENOM mRNA | CTD | PMID:17942748 | 4,4'-diaminodiphenylmethane | increases expression | ISO | RGD:1565037 | 6480464 | 4, 4'-diaminodiphenylmethane results in increased expression of SELENOM mRNA | CTD | PMID:25380136 | 4-hydroxyphenyl retinamide | increases expression | ISO | RGD:1622145 | 6480464 | Fenretinide results in increased expression of SELENOM mRNA | CTD | PMID:28973697 | 6-propyl-2-thiouracil | decreases expression | ISO | RGD:1565037 | 6480464 | Propylthiouracil results in decreased expression of SELENOM mRNA | CTD | PMID:24780913 | acetylsalicylic acid | increases expression | EXP | | 6480464 | Aspirin results in increased expression of SELENOM mRNA | CTD | PMID:11906190 | aflatoxin B1 | increases expression | EXP | | 6480464 | Aflatoxin B1 results in increased expression of SELENOM mRNA | CTD | PMID:27153756 | antirheumatic drug | decreases expression | EXP | | 6480464 | Antirheumatic Agents results in decreased expression of SELENOM mRNA | CTD | PMID:24449571 | Aroclor 1254 | increases expression | ISO | RGD:1622145 | 6480464 | Chlorodiphenyl (54% Chlorine) results in increased expression of SELENOM mRNA | CTD | PMID:23650126 | arsane | increases methylation | EXP | | 6480464 | Arsenic results in increased methylation of SELENOM promoter | CTD | PMID:21291286 | arsenic acid | decreases expression | ISO | RGD:1622145 | 6480464 | arsenic acid results in decreased expression of SELENOM mRNA | CTD | PMID:19429247 | arsenic atom | increases methylation | EXP | | 6480464 | Arsenic results in increased methylation of SELENOM promoter | CTD | PMID:21291286 | arsenite(3-) | decreases expression | ISO | RGD:1622145 | 6480464 | arsenite results in decreased expression of SELENOM mRNA | CTD | PMID:19429247 | benzo[a]pyrene | increases expression | ISO | RGD:1622145 | 6480464 | Benzo(a)pyrene results in increased expression of SELENOM mRNA | CTD | PMID:22228805 | bis(2-chloroethyl) sulfide | increases expression | EXP | | 6480464 | Mustard Gas results in increased expression of SELENOM mRNA | CTD | PMID:25102026 | bisphenol A | decreases expression | ISO | RGD:1622145 | 6480464 | bisphenol A results in decreased expression of SELENOM mRNA | CTD | PMID:26063408 | bisphenol A | decreases expression | ISO | RGD:1565037 | 6480464 | bisphenol A results in decreased expression of SELENOM mRNA | CTD | PMID:25181051 | Brodifacoum | decreases expression | ISO | RGD:1565037 | 6480464 | bromfenacoum results in decreased expression of SELM protein | CTD | PMID:28903499 | butanal | increases expression | EXP | | 6480464 | butyraldehyde results in increased expression of SELENOM mRNA | CTD | PMID:26079696 | cadmium dichloride | increases expression | ISO | RGD:1565037 | 6480464 | Cadmium Chloride results in increased expression of SELENOM mRNA | CTD | PMID:25993096 | choline | multiple interactions | ISO | RGD:1622145 | 6480464 | [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of SELENOM gene | CTD | PMID:20938992 | cyclosporin A | increases expression | ISO | RGD:1622145 | 6480464 | Cyclosporine results in increased expression of SELENOM mRNA | CTD | PMID:19770486 | cyclosporin A | increases expression | EXP | | 6480464 | Cyclosporine results in increased expression of SELENOM mRNA | CTD | PMID:20106945 | cytarabine | decreases expression | EXP | | 6480464 | Cytarabine results in decreased expression of SELENOM mRNA | CTD | PMID:21198554 | dibutyl phthalate | increases expression | ISO | RGD:1565037 | 6480464 | Dibutyl Phthalate results in increased expression of SELENOM mRNA | CTD | PMID:21266533 | diuron | increases expression | ISO | RGD:1565037 | 6480464 | Diuron results in increased expression of SELENOM mRNA | CTD | PMID:21551480 | dorsomorphin | multiple interactions | EXP | | 6480464 | [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... | CTD | PMID:27188386 | doxorubicin | decreases expression | EXP | | 6480464 | Doxorubicin results in decreased expression of SELENOM mRNA | CTD | PMID:29803840 | entinostat | increases expression | EXP | | 6480464 | entinostat results in increased expression of SELENOM mRNA | CTD | PMID:27188386 | folic acid | multiple interactions | ISO | RGD:1622145 | 6480464 | [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of SELENOM gene | CTD | PMID:20938992 | furan | increases expression | ISO | RGD:1565037 | 6480464 | furan results in increased expression of SELENOM mRNA | CTD | PMID:27387713 | L-methionine | multiple interactions | ISO | RGD:1622145 | 6480464 | [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of SELENOM gene | CTD | PMID:20938992 | mercury dibromide | decreases expression | EXP | | 6480464 | mercuric bromide results in decreased expression of SELENOM mRNA | CTD | PMID:26272509 | mercury dibromide | multiple interactions | EXP | | 6480464 | [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1, 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SELENOM mRNA | CTD | PMID:27188386 | metacetamol | decreases expression | ISO | RGD:1622145 | 6480464 | 3-hydroxyacetanilide results in decreased expression of SELENOM mRNA | CTD | PMID:18544908 | N-nitrosodimethylamine | increases expression | ISO | RGD:1565037 | 6480464 | Dimethylnitrosamine results in increased expression of SELENOM mRNA | CTD | PMID:25380136 | oxaliplatin | multiple interactions | ISO | RGD:1565037 | 6480464 | [oxaliplatin co-treated with Topotecan] results in increased expression of SELENOM mRNA | CTD | PMID:25729387 | oxaliplatin | increases expression | ISO | RGD:1565037 | 6480464 | oxaliplatin results in increased expression of SELENOM mRNA | CTD | PMID:25729387 | paracetamol | affects expression | ISO | RGD:1622145 | 6480464 | Acetaminophen affects the expression of SELENOM mRNA | CTD | PMID:17562736 | paracetamol | affects response to substance | EXP | | 6480464 | SELENOM gene polymorphism affects the susceptibility to Acetaminophen | CTD | PMID:26104854 | paracetamol | decreases expression | ISO | RGD:1622145 | 6480464 | Acetaminophen results in decreased expression of SELENOM mRNA | CTD | PMID:18544908 | phenylmercury acetate | decreases expression | EXP | | 6480464 | Phenylmercuric Acetate results in decreased expression of SELENOM mRNA | CTD | PMID:26272509 | phenylmercury acetate | multiple interactions | EXP | | 6480464 | [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1, 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SELENOM mRNA | CTD | PMID:27188386 | potassium chromate | increases expression | EXP | | 6480464 | potassium chromate(VI) results in increased expression of SELENOM mRNA | CTD | PMID:22714537 | SB 431542 | multiple interactions | EXP | | 6480464 | [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... | CTD | PMID:27188386 | silicon dioxide | decreases expression | ISO | RGD:1565037 | 6480464 | Silicon Dioxide results in decreased expression of SELENOM mRNA | CTD | PMID:22431001 | tetrachloromethane | affects expression | ISO | RGD:1622145 | 6480464 | Carbon Tetrachloride affects the expression of SELENOM mRNA | CTD | PMID:17484886 | tetrachloromethane | increases expression | ISO | RGD:1622145 | 6480464 | Carbon Tetrachloride results in increased expression of SELENOM mRNA | CTD | PMID:27339419 | thapsigargin | increases expression | EXP | | 6480464 | Thapsigargin results in increased expression of SELM mRNA | CTD | PMID:29453283 | topotecan | multiple interactions | ISO | RGD:1565037 | 6480464 | [oxaliplatin co-treated with Topotecan] results in increased expression of SELENOM mRNA | CTD | PMID:25729387 | topotecan | increases expression | ISO | RGD:1565037 | 6480464 | Topotecan results in increased expression of SELENOM mRNA | CTD | PMID:25729387 | trichostatin A | decreases expression | EXP | | 6480464 | trichostatin A results in decreased expression of SELENOM mRNA | CTD | PMID:26272509 | trichostatin A | multiple interactions | EXP | | 6480464 | [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1, 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SELENOM mRNA | CTD | PMID:27188386 | tungsten | decreases expression | ISO | RGD:1622145 | 6480464 | Tungsten results in decreased expression of SELM mRNA | CTD | PMID:30912803 | tunicamycin | increases expression | EXP | | 6480464 | Tunicamycin results in increased expression of SELENOM mRNA | CTD | PMID:22378314 | valproic acid | affects expression | EXP | | 6480464 | Valproic Acid affects the expression of SELENOM mRNA | CTD | PMID:25979313 | valproic acid | increases expression | EXP | | 6480464 | Valproic Acid results in increased expression of SELENOM mRNA, Valproic Acid results in increased expression of SELM mRNA | CTD | PMID:23179753 more ... | vinclozolin | decreases expression | ISO | RGD:1565037 | 6480464 | vinclozolin results in decreased expression of SELENOM mRNA | CTD | PMID:23034163 | |
|
|
|
|
|
|
|
|
|
PubMed | 11839807 12477932 15489334 18029348 24284396 24332979 25416956 25578973 26186194 27645994 28514442 |
SELENOM (Homo sapiens - human) |
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Selenom (Mus musculus - house mouse) |
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Selenom (Rattus norvegicus - Norway rat) |
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Selenom (Chinchilla lanigera - long-tailed chinchilla) |
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
SELENOM (Pan paniscus - bonobo/pygmy chimpanzee) |
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
SELENOM (Canis lupus familiaris - dog) |
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Selenom (Ictidomys tridecemlineatus - thirteen-lined ground squirrel) |
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
SELENOM (Sus scrofa - pig) |
|
SHGC-57277 |
|
|||||||||||||||||||||||||||||||||||
STS-W72233 |
|
The detailed report is available here: | ![]() | Full Report | ![]() | CSV | ![]() | TAB | ![]() | Printer |
miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/). For more information about miRGate, see PMID:25858286 or access the full paper here. |
RefSeq Transcripts | NM_080430 | (Get FASTA) | NCBI Sequence Viewer | Search GEO for Microarray Profiles |
GenBank Nucleotide | AC005005 | (Get FASTA) | NCBI Sequence Viewer | Search GEO for Microarray Profiles |
AY043487 | (Get FASTA) | NCBI Sequence Viewer | Search GEO for Microarray Profiles | |
BC013421 | (Get FASTA) | NCBI Sequence Viewer | Search GEO for Microarray Profiles | |
BC030236 | (Get FASTA) | NCBI Sequence Viewer | Search GEO for Microarray Profiles | |
BC042299 | (Get FASTA) | NCBI Sequence Viewer | Search GEO for Microarray Profiles | |
BC053846 | (Get FASTA) | NCBI Sequence Viewer | Search GEO for Microarray Profiles | |
BC068004 | (Get FASTA) | NCBI Sequence Viewer | Search GEO for Microarray Profiles | |
CH471095 | (Get FASTA) | NCBI Sequence Viewer | Search GEO for Microarray Profiles | |
HY137180 | (Get FASTA) | NCBI Sequence Viewer | Search GEO for Microarray Profiles |
RefSeq Acc Id: | NM_080430 ⟹ NP_536355 | ||||||||||||||||||||||||||||||||||
RefSeq Status: | REVIEWED | ||||||||||||||||||||||||||||||||||
Type: | CODING | ||||||||||||||||||||||||||||||||||
Position: |
|
||||||||||||||||||||||||||||||||||
Sequence: |
GGGGCCAGCCTGGGGGCCCAGACGTGGCGCAGCGACTCGGAGGTTCGCCTCCAGCTTGCGCATChide sequence |
Protein RefSeqs | NP_536355 | (Get FASTA) | NCBI Sequence Viewer |
GenBank Protein | AAH13421 | (Get FASTA) | NCBI Sequence Viewer |
AAH30236 | (Get FASTA) | NCBI Sequence Viewer | |
AAH68004 | (Get FASTA) | NCBI Sequence Viewer | |
AAK95397 | (Get FASTA) | NCBI Sequence Viewer | |
EAW59934 | (Get FASTA) | NCBI Sequence Viewer | |
EAW59935 | (Get FASTA) | NCBI Sequence Viewer | |
Q8WWX9 | (Get FASTA) | NCBI Sequence Viewer |
RefSeq Acc Id: | NP_536355 ⟸ NM_080430 |
- Peptide Label: | precursor |
- UniProtKB: | Q8WWX9 (UniProtKB/Swiss-Prot) |
- Sequence: |
MSLLLPPLALLLLLAALVAPATAATAYRPDWNRLSGLTRARVETCGGUQLNRLKEVKAFVTQDIhide sequence |
RGD ID: | 6800248 | |||||||||
Promoter ID: | HG_KWN:42379 | |||||||||
Type: | CpG-Island | |||||||||
SO ACC ID: | SO:0000170 | |||||||||
Source: | MPROMDB | |||||||||
Tissues & Cell Lines: | CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, K562, Lymphoblastoid | |||||||||
Transcripts: | ENST00000361918, ENST00000400299, OTTHUMT00000321790, OTTHUMT00000321791, OTTHUMT00000321792, OTTHUMT00000321793, OTTHUMT00000321794, OTTHUMT00000321795, OTTHUMT00000321796, UC010GWF.1 | |||||||||
Position: |
|
Name | Type | Condition(s) | Position(s) | Clinical significance |
GRCh38/hg38 22q11.21-12.3(chr22:18178957-31821193)x3 | copy number gain | Cholesteatoma [RCV000050768]|See cases [RCV000050768] | Chr22:18178957..31821193 [GRCh38] Chr22:18661724..32217179 [GRCh37] Chr22:17041724..30547179 [NCBI36] Chr22:22q11.21-12.3 |
pathogenic |
GRCh38/hg38 22q12.1-12.3(chr22:26979579-33992220)x3 | copy number gain | Global developmental delay [RCV000050553]|See cases [RCV000050553] | Chr22:26979579..33992220 [GRCh38] Chr22:27375542..34388209 [GRCh37] Chr22:25705542..32718209 [NCBI36] Chr22:22q12.1-12.3 |
pathogenic |
GRCh38/hg38 22q12.1-12.2(chr22:28278805-31742328)x1 | copy number loss | Global developmental delay [RCV000052870]|See cases [RCV000052870] | Chr22:28278805..31742328 [GRCh38] Chr22:28674793..32138314 [GRCh37] Chr22:27004793..30468314 [NCBI36] Chr22:22q12.1-12.2 |
pathogenic |
GRCh38/hg38 22q11.1-13.33(chr22:16916608-50739836)x3 | copy number gain | See cases [RCV000133646] | Chr22:16916608..50739836 [GRCh38] Chr22:17397498..51178264 [GRCh37] Chr22:15777498..49525130 [NCBI36] Chr22:22q11.1-13.33 |
pathogenic |
GRCh38/hg38 22q11.1-13.33(chr22:16916743-50739785)x3 | copy number gain | See cases [RCV000134730] | Chr22:16916743..50739785 [GRCh38] Chr22:17397633..51178213 [GRCh37] Chr22:15777633..49525079 [NCBI36] Chr22:22q11.1-13.33 |
pathogenic |
GRCh38/hg38 22q11.23-12.3(chr22:23279231-36247369)x3 | copy number gain | See cases [RCV000138172] | Chr22:23279231..36247369 [GRCh38] Chr22:23621418..36643415 [GRCh37] Chr22:21951418..34973361 [NCBI36] Chr22:22q11.23-12.3 |
pathogenic |
GRCh38/hg38 22q11.21-12.3(chr22:20907226-37187347)x3 | copy number gain | See cases [RCV000137926] | Chr22:20907226..37187347 [GRCh38] Chr22:21261514..37583387 [GRCh37] Chr22:19591514..35913333 [NCBI36] Chr22:22q11.21-12.3 |
pathogenic |
GRCh38/hg38 22q12.1-12.2(chr22:26451042-31451926)x1 | copy number loss | See cases [RCV000143415] | Chr22:26451042..31451926 [GRCh38] Chr22:26847008..31847912 [GRCh37] Chr22:25177008..30177912 [NCBI36] Chr22:22q12.1-12.2 |
pathogenic |
GRCh37/hg19 22q11.1-13.33(chr22:16054691-51237518)x3 | copy number gain | See cases [RCV000240091] | Chr22:16054691..51237518 [GRCh37] Chr22:22q11.1-13.33 |
pathogenic |
GRCh37/hg19 22q11.1-13.33(chr22:16054691-51220902)x3 | copy number gain | See cases [RCV000446956] | Chr22:16054691..51220902 [GRCh37] Chr22:22q11.1-13.33 |
pathogenic |
GRCh37/hg19 22q11.1-13.33(chr22:16054691-51237463)x3 | copy number gain | See cases [RCV000448847] | Chr22:16054691..51237463 [GRCh37] Chr22:22q11.1-13.33 |
pathogenic |
GRCh37/hg19 22q12.1-12.3(chr22:28349854-33013062)x3 | copy number gain | See cases [RCV000510523] | Chr22:28349854..33013062 [GRCh37] Chr22:22q12.1-12.3 |
likely pathogenic |
GRCh37/hg19 22q11.23-12.3(chr22:23637907-36614412)x3 | copy number gain | See cases [RCV000511098] | Chr22:23637907..36614412 [GRCh37] Chr22:22q11.23-12.3 |
pathogenic |
GRCh37/hg19 22q11.1-13.33(chr22:16888900-51197838) | copy number gain | See cases [RCV000510873] | Chr22:16888900..51197838 [GRCh37] Chr22:22q11.1-13.33 |
pathogenic |
GRCh37/hg19 22q11.1-13.33(chr22:16888900-51197838)x3 | copy number gain | See cases [RCV000512333] | Chr22:16888900..51197838 [GRCh37] Chr22:22q11.1-13.33 |
pathogenic |
GRCh37/hg19 22q11.22-12.3(chr22:22460754-35198232)x3 | copy number gain | not provided [RCV000684530] | Chr22:22460754..35198232 [GRCh37] Chr22:22q11.22-12.3 |
pathogenic |
GRCh37/hg19 22q11.1-13.33(chr22:16054667-51243435)x3 | copy number gain | not provided [RCV000741689] | Chr22:16054667..51243435 [GRCh37] Chr22:22q11.1-13.33 |
pathogenic |
GRCh37/hg19 22q11.1-13.33(chr22:16114244-51195728)x3 | copy number gain | not provided [RCV000741691] | Chr22:16114244..51195728 [GRCh37] Chr22:22q11.1-13.33 |
pathogenic |
GRCh37/hg19 22q11.1-13.33(chr22:16114244-51211392)x3 | copy number gain | not provided [RCV000741692] | Chr22:16114244..51211392 [GRCh37] Chr22:22q11.1-13.33 |
pathogenic |
inv(22)(q12.2q12.2) | inversion | Anaplastic ependymoma [RCV000785873] | Chr22:29684716..31740655 [GRCh37] Chr22:22q12.2 |
likely pathogenic |
GRCh37/hg19 22q11.1-13.33(chr22:16888899-51197838)x3 | copy number gain | not provided [RCV000846344] | Chr22:16888899..51197838 [GRCh37] Chr22:22q11.1-13.33 |
pathogenic |
Database | Acc Id | Source(s) |
AGR Gene | HGNC:30397 | AgrOrtholog |
COSMIC | SELENOM | COSMIC |
Ensembl Genes | ENSG00000198832 | ENTREZGENE, UniProtKB/Swiss-Prot |
Ensembl Protein | ENSP00000383155 | ENTREZGENE, UniProtKB/Swiss-Prot |
ENSP00000384564 | UniProtKB/Swiss-Prot | |
ENSP00000480176 | UniProtKB/TrEMBL | |
Ensembl Transcript | ENST00000400299 | ENTREZGENE, UniProtKB/Swiss-Prot |
ENST00000402395 | UniProtKB/Swiss-Prot | |
ENST00000611680 | UniProtKB/TrEMBL | |
Gene3D-CATH | 3.40.30.50 | UniProtKB/Swiss-Prot |
GTEx | ENSG00000198832 | GTEx |
HGNC ID | HGNC:30397 | ENTREZGENE |
Human Proteome Map | SELENOM | Human Proteome Map |
InterPro | Sep15/SelM_sf | UniProtKB/Swiss-Prot |
Sep15_SelM | UniProtKB/Swiss-Prot | |
Sep15_SelM_dom | UniProtKB/Swiss-Prot | |
Thioredoxin-like_sf | UniProtKB/Swiss-Prot | |
KEGG Report | hsa:140606 | UniProtKB/Swiss-Prot |
NCBI Gene | 140606 | ENTREZGENE |
OMIM | 610918 | OMIM |
PANTHER | PTHR13077 | UniProtKB/Swiss-Prot |
Pfam | Sep15_SelM | UniProtKB/Swiss-Prot |
PharmGKB | PA166181631 | PharmGKB |
Superfamily-SCOP | SSF52833 | UniProtKB/Swiss-Prot |
UniGene | Hs.55940 | ENTREZGENE |
UniProt | A0A087WWF1_HUMAN | UniProtKB/TrEMBL |
Q8WWX9 | ENTREZGENE, UniProtKB/Swiss-Prot | |
UniProt Secondary | A8MPZ2 | UniProtKB/Swiss-Prot |
Date | Current Symbol | Current Name | Previous Symbol | Previous Name | Description | Reference | Status |
---|---|---|---|---|---|---|---|
2016-09-27 | SELENOM | selenoprotein M | SELM | Symbol and/or name change | 5135510 | APPROVED | |
2011-09-01 | SELM | selenoprotein M | SELM | selenoprotein M | Symbol and/or name change | 5135510 | APPROVED |
![]() |
More on SELENOM | |
![]() |
Alliance Gene |
![]() |
NCBI Gene |
![]() |
Ensembl Gene |
![]() |
JBrowse: hg19 hg38 |
![]() |
HGNC Report |
![]() |
NCBI Genome Data Viewer |
CRRD Object Information | |
CRRD ID: | 1603181 |
Created: | 2007-04-28 |
Species: | Homo sapiens |
Last Modified: | 2019-11-26 |
Status: | ACTIVE |
![]() |
![]() |
![]() |
![]() |
RGD is funded by grant HL64541 from the National Heart, Lung, and Blood Institute on behalf of the NIH.